IP (Immunoprecipitation)
(Immunoprecipitation of CTP synthase / CTPS from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase / CTPS Rabbit mAb (AAA282863). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase / CTPS Rabbit mAb (AAA282863) at a dilution of 1:500.)
Rabbit anti-Human CTP synthase/CTPS Monoclonal Antibody | anti-CTPS1 antibody
CTP synthase/CTPS Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
CTP synthase/CTPS, Antibody; CTP synthase/CTPS Rabbit mAb; CTPS; GATD5; IMD24; GATD5A; CTP synthase/CTPS; anti-CTPS1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
Applicable Applications for anti-CTPS1 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase/CTPS (P17812).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of CTP synthase / CTPS from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase / CTPS Rabbit mAb (AAA282863). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase / CTPS Rabbit mAb (AAA282863) at a dilution of 1:500.)
IP (Immunoprecipitation)
(Immunoprecipitation of CTP synthase / CTPS from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase / CTPS Rabbit mAb (AAA282863). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase / CTPS Rabbit mAb (AAA282863) at a dilution of 1:500.)
WB (Western Blot)
(Western blot analysis of various lysates using CTP synthase / CTPS Rabbit mAb (AAA282863) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using CTP synthase / CTPS Rabbit mAb (AAA282863) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using CTP synthase / CTPS Rabbit mAb (AAA282863) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of various lysates using CTP synthase / CTPS Rabbit mAb (AAA282863) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-CTPS1 antibody
This gene encodes an enzyme responsible for the catalytic conversion of UTP (uridine triphosphate) to CTP (cytidine triphospate). This reaction is an important step in the biosynthesis of phospholipids and nucleic acids. Activity of this proten is important in the immune system, and loss of function of this gene has been associated with immunodeficiency. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CTPS1 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The CTPS1 ctps1 (Catalog #AAA282863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTP synthase/CTPS Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTP synthase/CTPS can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the CTPS1 ctps1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVRELRGLGL SPDLVVCRCS NPLDTSVKEK ISMFCHVEPE QVICVHDVSS IYRVPLLLEE QGVVDYFLRR LDLPIERQPR KMLMKWKEMA DRYDRLLETC S. It is sometimes possible for the material contained within the vial of "CTP synthase/CTPS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.