Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282956_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit anti-Human Cyclin E1 Monoclonal Antibody | anti-CCNE1 antibody

Cyclin E1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Cyclin E1, Antibody; Cyclin E1 Rabbit mAb; CCNE; pCCNE1; Cyclin E1; anti-CCNE1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG
Applicable Applications for anti-CCNE1 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,0.05% BSA,50% glycerol,pH7.3.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282956_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282956_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282956_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282956_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Cyclin E1 Rabbit mAb (AAA282956) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen, using Cyclin E1 Rabbit mAb (AAA282956) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA282956_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse spleen, using Cyclin E1 Rabbit mAb (AAA282956) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CCNE1 antibody
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
898
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 47kDa
Observed MW: 48kDa
UniProt Protein Name
G1/S-specific cyclin-E1
UniProt Gene Name
CCNE1
UniProt Synonym Gene Names
CCNE
UniProt Entry Name
CCNE1_HUMAN

Similar Products

Product Notes

The CCNE1 ccne1 (Catalog #AAA282956) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin E1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin E1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CCNE1 ccne1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AASALYHFSS SELMQKVSGY QWCDIENCVK WMVPFAMVIR ETGSSKLKHF RGVADEDAHN IQTHRDSLDL LDKARAKKAM LSEQNRASPL PSGLLTPPQS G. It is sometimes possible for the material contained within the vial of "Cyclin E1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.