Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125147_IF11.jpg IF (Immunofluorescence) (Figure 3. IF analysis of Cytokeratin 19 using anti- Cytokeratin 19 antibody (M02101-2).Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti- Cytokeratin 19 Antibody (M02101-2) overnight at 4 degree C. DyLight550 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:200 dilution and incubated for 30 minutes at 37 degree C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Mouse anti-Human Cytokeratin 19 Monoclonal Antibody | anti-KRT19 antibody

Anti-Cytokeratin 19 Antibody (monoclonal, 3D4)

Average rating 0.0
No ratings yet
Gene Names
KRT19; K19; CK19; K1CS
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Cytokeratin 19, Antibody; Anti-Cytokeratin 19 Antibody (monoclonal, 3D4); Keratin, type I cytoskeletal 19; Cytokeratin-19; CK-19; Keratin-19; K19; KRT19; Keratin 19; anti-KRT19 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
3D4
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
400
Applicable Applications for anti-KRT19 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

IF (Immunofluorescence)

(Figure 3. IF analysis of Cytokeratin 19 using anti- Cytokeratin 19 antibody (M02101-2).Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti- Cytokeratin 19 Antibody (M02101-2) overnight at 4 degree C. DyLight550 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:200 dilution and incubated for 30 minutes at 37 degree C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA125147_IF11.jpg IF (Immunofluorescence) (Figure 3. IF analysis of Cytokeratin 19 using anti- Cytokeratin 19 antibody (M02101-2).Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti- Cytokeratin 19 Antibody (M02101-2) overnight at 4 degree C. DyLight550 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:200 dilution and incubated for 30 minutes at 37 degree C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IF (Immunofluorescence)

(Figure 3. IF analysis of Cytokeratin 19 using anti- Cytokeratin 19 antibody (M02101-2).Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti- Cytokeratin 19 Antibody (M02101-2) overnight at 4 degree C. DyLight550 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:200 dilution and incubated for 30 minutes at 37 degree C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA125147_IF13.jpg IF (Immunofluorescence) (Figure 3. IF analysis of Cytokeratin 19 using anti- Cytokeratin 19 antibody (M02101-2).Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti- Cytokeratin 19 Antibody (M02101-2) overnight at 4 degree C. DyLight550 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:200 dilution and incubated for 30 minutes at 37 degree C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody (M02101-2).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human placenta tissue lysates,Lane 3: human SK-OV-3 whole cell lysates,Lane 4: human COLO-320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Cytokeratin 19 antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)

product-image-AAA125147_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody (M02101-2).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human placenta tissue lysates,Lane 3: human SK-OV-3 whole cell lysates,Lane 4: human COLO-320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Cytokeratin 19 antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)
Related Product Information for anti-KRT19 antibody
Description: Mouse IgG monoclonal antibody for Cytokeratin 19 detection. Tested with WB, IHC-P, IF in Human.
Background: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
References
1. "Entrez Gene: KRT19 keratin 19". 2. Schweizer J, Bowden PE, Coulombe PA, Langbein L, Lane EB, Magin TM, Maltais L, Omary MB, Parry DA, Rogers MA, Wright MW (Jul 2006). "New consensus nomenclature for mammalian keratins". J Cell Biol 174 (2): 169-74. 3. W. Jeffrey Allard, Jeri Matera, M. Craig Miller, et al. (October 2004). "Tumor Cells Circulate in the Peripheral Blood of All Major Carcinomas but not in Healthy Subjects or Patients With Nonmalignant Diseases". Clin. Cancer Research 10 (20): 6897-6904.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,106 Da
NCBI Official Full Name
keratin, type I cytoskeletal 19
NCBI Official Synonym Full Names
keratin 19
NCBI Official Symbol
KRT19
NCBI Official Synonym Symbols
K19; CK19; K1CS
NCBI Protein Information
keratin, type I cytoskeletal 19
UniProt Protein Name
Keratin, type I cytoskeletal 19
UniProt Gene Name
KRT19
UniProt Synonym Gene Names
CK-19; K19

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT19 krt19 (Catalog #AAA125147) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cytokeratin 19 Antibody (monoclonal, 3D4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 19 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KRT19 krt19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytokeratin 19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.