Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Cart Login
product-image-AAA28447_IHC8.jpg
IHC (Immunohistochemistry)
>
<
product-image-AAA28447_IHC7.jpg
product-image-AAA28447_IHC6.jpg
product-image-AAA28447_IHC5.jpg
product-image-AAA28447_IHC4.jpg
product-image-AAA28447_WB3.jpg
product-image-AAA28447_WB2.jpg
product-image-AAA28447_WB.jpg
product-image-AAA28447_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit anti-Human Cytokeratin 19 (KRT19) Monoclonal Antibody | anti-KRT19 antibody

Cytokeratin 19 (KRT19) Rabbit PolymAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
Cytokeratin 19 (KRT19), Antibody; Cytokeratin 19 (KRT19) Rabbit PolymAb; K19; CK19; K1CS; anti-KRT19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
TDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Applicable Applications for anti-KRT19 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1000-1:10000
IHC-P: 1:4000-1:20000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 243-400 of human Cytokeratin 19 (KRT19)(NP_002267.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28447_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28447_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28447_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28447_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

product-image-AAA28447_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28447_WB3.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of lysates from Rat lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28447_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from Rat lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of lysates from Hep G2 cells using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28447_WB.jpg WB (Western Blot) (Western blot analysis of lysates from Hep G2 cells using Cytokeratin 19 (KRT19) Rabbit PolymAb® (AAA28447) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-KRT19 antibody
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Product Categories/Family for anti-KRT19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 44kDa
Observed MW: 44kDa
UniProt Protein Name
Keratin, type I cytoskeletal 19
UniProt Gene Name
KRT19
UniProt Synonym Gene Names
CK-19; K19
UniProt Entry Name
K1C19_HUMAN

Similar Products

product-image-AAA28472_IF10.jpg

KRT19 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
product-image-AAA21322_IHC6.jpg

KRT19 Antibody

Host: Rabbit
Reactivity: Mouse, Rat, Human
Apps: Immunohistochemistry, Immunohistochemistry, Western Blot
product-image-AAA29010_IHC7.jpg

KRT19 Antibody

Host: Rabbit
Reactivity: Human, Mouse, Rat
Apps: Western Blot, Immunohistochemistry, Immunofluorescence
product-image-AAA21523_SC.jpg

CK-19/KRT19 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA29981_FCM7.jpg

Cytokeratin 19 Antibody

Host: Rabbit
Reactivity: Human, Mouse
Apps: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Flow Cytometry, Functional Assay
product-image-AAA30883_APP7.png

CK19 Antibody

Host: Mouse
Reactivity: Human
Apps: Immunohistochemistry, Western Blot, Immunofluorescence, ELISA
product-image-AAA12566_SC.jpg

CK-19 ELISA Kit

Host: n/a
Reactivity: Chicken
Apps: n/a
product-image-AAA21264_WB6.jpg

CK19 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation
product-image-AAA11064_WB2.jpg

COVID-19 Antibody

Host: n/a
Reactivity: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), SARS-COV
Apps: Western Blot, ELISA
product-image-AAA22149_IF.jpg

COVID-19 Antibody

Host: Mouse / Human
Reactivity: SARS-COV2
Apps: ELISA, Immunofluorescence
product-image-AAA14562_APP7.jpg

CytokeRatin 19 / KeRatin K19 Antibody

Host: Mouse
Reactivity: Human, Zebrafish
Apps: Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Immunohistochemistry, Immunohistochemistry, Western Blot
product-image-AAA27967_APP.jpg

COVID-19 Antibody

Host: Humanized
Reactivity: n/a
Apps: n/a
product-image-AAA27966_SDS_PAGE.jpg

COVID-19 Recombinant Protein

Host: HEK293
Reactivity: n/a
Apps: n/a
product-image-AAA13620_SC.jpg

COVID-19 ELISA Kit

Host: n/a
Reactivity: n/a
Apps: n/a
product-image-AAA13615_SC.jpg

COVID-19 ELISA Kit

Host: n/a
Reactivity: n/a
Apps: n/a
product-image-AAA27032_WB3.jpg

COVID-19 Active Protein

Host: E Coli
Reactivity: n/a
Apps: n/a
product-image-AAA28310_SC.jpg

COVID-19 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA13644_QC.jpg

COVID-19 ELISA Plate

Host: n/a
Reactivity: n/a
Apps: n/a
product-image-AAA27039_APP2.jpg

COVID-19 Reagent

Host: n/a
Reactivity: n/a
Apps: n/a

Product Notes

The KRT19 krt19 (Catalog #AAA28447) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytokeratin 19 (KRT19) Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 19 (KRT19) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1000-1:10000 IHC-P: 1:4000-1:20000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the KRT19 krt19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TDLAKILSDM RSQYEVMAEQ NRKDAEAWFT SRTEELNREV AGHTEQLQMS RSEVTDLRRT LQGLEIELQS QLSMKAALED TLAETEARFG AQLAHIQALI SGIEAQLGDV RADSERQNQE YQRLMDIKSR LEQEIATYRS LLEGQEDHYN NLSASKVL. It is sometimes possible for the material contained within the vial of "Cytokeratin 19 (KRT19), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.