Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25072_WB6.jpg WB (Western Blot) (DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in A-431.)

Mouse anti-Human, Rat DAAM1 Monoclonal Antibody | anti-DAAM1 antibody

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (FITC)

Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAAM1, Antibody; DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (FITC); anti-DAAM1 antibody
Ordering
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H3
Specificity
Recognizes human DAAM1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DAAM1 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from DAAM1 (NP_055807) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in A-431.)

product-image-AAA25072_WB6.jpg WB (Western Blot) (DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in A-431.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with RHOA rabbit purified polyclonal 1:1200 and DAAM1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA25072_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with RHOA rabbit purified polyclonal 1:1200 and DAAM1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged DAAM1 is ~1ng/ml as a capture antibody.)

product-image-AAA25072_APP4.jpg Application Data (Detection limit for recombinant GST tagged DAAM1 is ~1ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody. Lane 1: DAAM1 transfected lysate (122.3kD). Lane 2: Non-transfected lysate.)

product-image-AAA25072_WB3.jpg WB (Western Blot) (Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody. Lane 1: DAAM1 transfected lysate (122.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in PC-12.)

product-image-AAA25072_WB2.jpg WB (Western Blot) (DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

product-image-AAA25072_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-DAAM1 antibody
Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Recent evidence suggests a role for the Formin homology (FH) proteins in these processes. DAAM1 contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by DAAM1, which is thought to function as a scaffolding protein.
Product Categories/Family for anti-DAAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
disheveled-associated activator of morphogenesis 1 isoform 1
NCBI Official Synonym Full Names
dishevelled associated activator of morphogenesis 1
NCBI Official Symbol
DAAM1
NCBI Protein Information
disheveled-associated activator of morphogenesis 1
UniProt Protein Name
Disheveled-associated activator of morphogenesis 1
UniProt Gene Name
DAAM1
UniProt Synonym Gene Names
KIAA0666
UniProt Entry Name
DAAM1_HUMAN

Similar Products

Product Notes

The DAAM1 daam1 (Catalog #AAA25072) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DAAM1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAAM1 daam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAAM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.