Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24185_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human DARS Monoclonal Antibody | anti-DARS antibody

DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) (AP)

Gene Names
DARS; HBSL; aspRS
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DARS, Antibody; DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) (AP); anti-DARS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human DARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DARS antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa393-500 from human DARS (NP_001340) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.62kD).)

product-image-AAA24185_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.62kD).)
Product Categories/Family for anti-DARS antibody
References
1. Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome? Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.Neoplasia. 2009 Nov;11(11):1194-207.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59.3 kDa (521aa)
NCBI Official Full Name
aspartate--tRNA ligase, cytoplasmic isoform 1
NCBI Official Synonym Full Names
aspartyl-tRNA synthetase
NCBI Official Symbol
DARS
NCBI Official Synonym Symbols
HBSL; aspRS
NCBI Protein Information
aspartate--tRNA ligase, cytoplasmic
UniProt Protein Name
Aspartate--tRNA ligase, cytoplasmic
UniProt Gene Name
DARS
UniProt Synonym Gene Names
AspRS
UniProt Entry Name
SYDC_HUMAN

Similar Products

Product Notes

The DARS dars (Catalog #AAA24185) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DARS can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DARS dars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DARS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.