Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25369_WB7.jpg WB (Western Blot) (DCUN1D1 monoclonal antibody, Western Blot analysis of DCUN1D1 expression in HepG2.)

Mouse DCUN1D1 Monoclonal Antibody | anti-DCUN1D1 antibody

DCUN1D1 (DCN1-like Protein 1, DCUN1 Domain-containing Protein 1, Defective in Cullin Neddylation Protein 1-like Protein 1, Squamous Cell Carcinoma-related Oncogene, DCUN1L1, RP42, SCCRO) (HRP)

Gene Names
DCUN1D1; RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DCUN1D1, Antibody; DCUN1D1 (DCN1-like Protein 1, DCUN1 Domain-containing Protein 1, Defective in Cullin Neddylation Protein 1-like Protein 1, Squamous Cell Carcinoma-related Oncogene, DCUN1L1, RP42, SCCRO) (HRP); anti-DCUN1D1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D7
Specificity
Recognizes human DCUN1D1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DCUN1D1 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human DCUN1D1 (NP_065691) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(DCUN1D1 monoclonal antibody, Western Blot analysis of DCUN1D1 expression in HepG2.)

product-image-AAA25369_WB7.jpg WB (Western Blot) (DCUN1D1 monoclonal antibody, Western Blot analysis of DCUN1D1 expression in HepG2.)

WB (Western Blot)

(DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in PC-12.)

product-image-AAA25369_WB6.jpg WB (Western Blot) (DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in PC-12.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to DCUN1D1 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25369_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to DCUN1D1 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of DCUN1D1 expression in transfected 293T cell line by DCUN1D1 monoclonal antibody. Lane 1: DCUN1D1 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA25369_WB4.jpg WB (Western Blot) (Western Blot analysis of DCUN1D1 expression in transfected 293T cell line by DCUN1D1 monoclonal antibody. Lane 1: DCUN1D1 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in NIH/3T3.)

product-image-AAA25369_WB3.jpg WB (Western Blot) (DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in NIH/3T3.)

WB (Western Blot)

(DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in Raw 264.7.)

product-image-AAA25369_WB2.jpg WB (Western Blot) (DCUN1D1 monoclonal antibody. Western Blot analysis of DCUN1D1 expression in Raw 264.7.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.9kD).)

product-image-AAA25369_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.9kD).)
Related Product Information for anti-DCUN1D1 antibody
Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Product Categories/Family for anti-DCUN1D1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.2 kDa (279aa), confirmed by MALDI-TOF
NCBI Official Full Name
DCN1-like protein 1 isoform 1
NCBI Official Synonym Full Names
defective in cullin neddylation 1 domain containing 1
NCBI Official Symbol
DCUN1D1
NCBI Official Synonym Symbols
RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
NCBI Protein Information
DCN1-like protein 1
UniProt Protein Name
DCN1-like protein 1
UniProt Gene Name
DCUN1D1
UniProt Synonym Gene Names
DCUN1L1; RP42; SCCRO
UniProt Entry Name
DCNL1_HUMAN

Similar Products

Product Notes

The DCUN1D1 dcun1d1 (Catalog #AAA25369) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCUN1D1 (DCN1-like Protein 1, DCUN1 Domain-containing Protein 1, Defective in Cullin Neddylation Protein 1-like Protein 1, Squamous Cell Carcinoma-related Oncogene, DCUN1L1, RP42, SCCRO) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DCUN1D1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCUN1D1 dcun1d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCUN1D1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.