Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA26253_APP6.jpg Application Data (Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.)

Mouse DDX56 Monoclonal Antibody | anti-DDX56 antibody

DDX56 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56, DDX21, DDX26, NOH61) (Biotin)

Gene Names
DDX56; DDX21; DDX26; NOH61
Applications
Western Blot
Purity
Purified
Synonyms
DDX56, Antibody; DDX56 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56, DDX21, DDX26, NOH61) (Biotin); DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56; DDX21; DDX26; NOH61; anti-DDX56 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6B9
Specificity
Recognizes DDX56.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DDX56 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DDX56 (NP_061955, 450aa-547aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.)

product-image-AAA26253_APP6.jpg Application Data (Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.)

WB (Western Blot)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7.)

product-image-AAA26253_WB5.jpg WB (Western Blot) (DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7.)

WB (Western Blot)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in NIH/3T3.)

product-image-AAA26253_WB4.jpg WB (Western Blot) (DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in NIH/3T3.)

WB (Western Blot)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12 (Cat # L012V1).)

product-image-AAA26253_WB3.jpg WB (Western Blot) (DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HepG2 (Cat # L019V1).)

product-image-AAA26253_WB2.jpg WB (Western Blot) (DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HepG2 (Cat # L019V1).)

WB (Western Blot)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa (Cat # L013V1).)

product-image-AAA26253_WB.jpg WB (Western Blot) (DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa (Cat # L013V1).)
Related Product Information for anti-DDX56 antibody
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit. [provided by RefSeq]
Product Categories/Family for anti-DDX56 antibody
References
1. Quantitative Proteomics and Dynamic Imaging of the Nucleolus Reveal Distinct Responses to UV and Ionizing Radiation.Moore HM, Bai B, Boisvert FM, Latonen L, Rantanen V, Simpson JC, Pepperkok R, Lamond AI, Laiho M.Mol Cell Proteomics. 2011 Oct;10(10):M111. 009241. Epub 2011 Jul 21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64.0 kDa (570aa)
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX56 isoform 1
NCBI Official Synonym Full Names
DEAD-box helicase 56
NCBI Official Symbol
DDX56
NCBI Official Synonym Symbols
DDX21; DDX26; NOH61
NCBI Protein Information
probable ATP-dependent RNA helicase DDX56
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX56
UniProt Gene Name
DDX56
UniProt Synonym Gene Names
DDX21; NOH61
UniProt Entry Name
DDX56_HUMAN

Similar Products

Product Notes

The DDX56 ddx56 (Catalog #AAA26253) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DDX56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX56 ddx56 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX56, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.