Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24080_WB7.jpg WB (Western Blot) (Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human ENO3 Monoclonal Antibody | anti-ENO3 antibody

ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase)

Gene Names
ENO3; MSE; GSD13
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ENO3, Antibody; ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase); Anti -ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase); anti-ENO3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D1
Specificity
Recognizes human ENO3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Applicable Applications for anti-ENO3 antibody
ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 1.5-3ug/ml
Immunogen
Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24080_WB7.jpg WB (Western Blot) (Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24080_APP6.jpg Application Data (Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24080_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

product-image-AAA24080_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

product-image-AAA24080_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody.Lane 1: ENO3 transfected lysate (46.9kD).Lane 2: Non-transfected lysate.)

product-image-AAA24080_WB2.jpg WB (Western Blot) (Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody.Lane 1: ENO3 transfected lysate (46.9kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (31.24kD).)

product-image-AAA24080_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (31.24kD).)
Related Product Information for anti-ENO3 antibody
ENO3, is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. ENO3 play a role in converting phosphoglyceric acid to phosphenolpyruvic acid in the glycolytic pathway. Mutations in its gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.
Product Categories/Family for anti-ENO3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,987 Da
NCBI Official Full Name
enolase
NCBI Official Synonym Full Names
enolase 3 (beta, muscle)
NCBI Official Symbol
ENO3
NCBI Official Synonym Symbols
MSE; GSD13
NCBI Protein Information
beta-enolase; muscle-specific enolase; skeletal muscle enolase; 2-phospho-D-glycerate hydrolyase
UniProt Protein Name
Beta-enolase
UniProt Gene Name
ENO3
UniProt Synonym Gene Names
MSE
UniProt Entry Name
ENOB_HUMAN

Similar Products

Product Notes

The ENO3 eno3 (Catalog #AAA24080) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENO3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5-3ug/ml. Researchers should empirically determine the suitability of the ENO3 eno3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KTAIQAAGYP DKVVIGMDVA ASEFYRNGKY DLDFKSPDDP ARHITGEKLG. It is sometimes possible for the material contained within the vial of "ENO3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.