Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282790_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug FANCD2 Rabbit mAb (AAA282790). Western blot was performed from the immunoprecipitate using FANCD2 Rabbit mAb (AAA282790) at a dilition of 1:1000.)

Rabbit anti-Human FANCD2 Monoclonal Antibody | anti-FANCD2 antibody

FANCD2 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
FANCD2, Antibody; FANCD2 Rabbit mAb; FA4; FAD; FACD; FAD2; FA-D2; FANCD; FANCD2; anti-FANCD2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
ISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISE
Applicable Applications for anti-FANCD2 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human FANCD2 (Q9BXW9).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug FANCD2 Rabbit mAb (AAA282790). Western blot was performed from the immunoprecipitate using FANCD2 Rabbit mAb (AAA282790) at a dilition of 1:1000.)

product-image-AAA282790_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug FANCD2 Rabbit mAb (AAA282790). Western blot was performed from the immunoprecipitate using FANCD2 Rabbit mAb (AAA282790) at a dilition of 1:1000.)

WB (Western Blot)

(Western blot analysis of lysates from mouse testis, using FANCD2 Rabbit mAb (AAA282790) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA282790_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from mouse testis, using FANCD2 Rabbit mAb (AAA282790) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using FANCD2 Rabbit mAb (AAA282790) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA282790_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using FANCD2 Rabbit mAb (AAA282790) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-FANCD2 antibody
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group D2. This protein is monoubiquinated in response to DNA damage, resulting in its localization to nuclear foci with other proteins (BRCA1 AND BRCA2) involved in homology-directed DNA repair. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 164kDa
Observed MW: 166kDa
UniProt Protein Name
Fanconi anemia group D2 protein
UniProt Gene Name
FANCD2
UniProt Synonym Gene Names
FACD; Protein FACD2
UniProt Entry Name
FACD2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FANCD2 fancd2 (Catalog #AAA282790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FANCD2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FANCD2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the FANCD2 fancd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ISIAPENLQH DIITSLPEIL GDSQHADVGK ELSDLLIENT SLTVPILDVL SSLRLDPNFL LKVRQLVMDK LSSIRLEDLP VIIKFILHSV TAMDTLEVIS E. It is sometimes possible for the material contained within the vial of "FANCD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.