Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody. Lane 1: AFP transfected lysate (69kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human Fetoprotein, Alpha Monoclonal Antibody | anti-FETA antibody

Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (Biotin)

Gene Names
AFP; AFPD; FETA; HPAFP
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Fetoprotein; Alpha; Monoclonal Antibody; Alpha (AFP; Alpha1-fetoprotein; Alpha-fetoglobulin; Alpha-fetoprotein precursor; FETA; HPAFP) (Biotin); anti-FETA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1G7
Specificity
Recognizes human AFP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FETA antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa500-609 from human AFP (AAH27881) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody. Lane 1: AFP transfected lysate (69kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody. Lane 1: AFP transfected lysate (69kD). Lane 2: Non-transfected lysate.)

Application Data

(Detection limit for recombinant GST tagged AFP is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged AFP is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of AFP transfected lysate using AFP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with AFP rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of AFP transfected lysate using AFP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with AFP rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30ug/ml].)

WB (Western Blot)

(AFP monoclonal antibody Western Blot analysis of AFP expression in HepG2.)

WB (Western Blot) (AFP monoclonal antibody Western Blot analysis of AFP expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.84kD).)
Product Categories/Family for anti-FETA antibody
References
1. Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis. Ramon-Azcon J, Yasukawa T, Mizutani F.Biosens Bioelectron. 2011 Aug 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
174
UniProt Accession #
Molecular Weight
68,678 Da
NCBI Official Full Name
Homo sapiens alpha-fetoprotein, mRNA
NCBI Official Synonym Full Names
alpha fetoprotein
NCBI Official Symbol
AFP
NCBI Official Synonym Symbols
AFPD; FETA; HPAFP
NCBI Protein Information
alpha-fetoprotein
UniProt Protein Name
Alpha-fetoprotein
UniProt Gene Name
AFP
UniProt Synonym Gene Names
HPAFP
UniProt Entry Name
FETA_HUMAN

Similar Products

Product Notes

The FETA afp (Catalog #AAA24716) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Fetoprotein, Alpha can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FETA afp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fetoprotein, Alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.