Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283083_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human kidney tissue using FGF1 Rabbit PolymAb® (AAA283083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit anti-Human FGF1 Monoclonal Antibody | anti-FGF1 antibody

FGF1 Rabbit PolymAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
FGF1, Antibody; FGF1 Rabbit PolymAb; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; anti-FGF1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
HIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Applicable Applications for anti-FGF1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 56-155 of human FGF1 (P05230).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human kidney tissue using FGF1 Rabbit PolymAb® (AAA283083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA283083_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human kidney tissue using FGF1 Rabbit PolymAb® (AAA283083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using FGF1 Rabbit PolymAb® (AAA283083) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA283083_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using FGF1 Rabbit PolymAb® (AAA283083) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using FGF1 Rabbit PolymAb® (AAA283083) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA283083_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using FGF1 Rabbit PolymAb® (AAA283083) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using FGF1 Rabbit PolymAb® (AAA283083)at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): K-562Exposure time: 45s.)

product-image-AAA283083_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using FGF1 Rabbit PolymAb® (AAA283083)at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): K-562Exposure time: 45s.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse brain using FGF1 Rabbit PolymAb® (AAA283083) at 1:15000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283083_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse brain using FGF1 Rabbit PolymAb® (AAA283083) at 1:15000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-FGF1 antibody
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 17kDa
Observed MW: 17kDa
UniProt Protein Name
Fibroblast growth factor 1
UniProt Gene Name
FGF1
UniProt Synonym Gene Names
FGFA; FGF-1; aFGF; ECGF; HBGF-1
UniProt Entry Name
FGF1_HUMAN

Similar Products

Product Notes

The FGF1 fgf1 (Catalog #AAA283083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF1 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FGF1 fgf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HIQLQLSAES VGEVYIKSTE TGQYLAMDTD GLLYGSQTPN EECLFLERLE ENHYNTYISK KHAEKNWFVG LKKNGSCKRG PRTHYGQKAI LFLPLPVSSD. It is sometimes possible for the material contained within the vial of "FGF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.