Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14772_WB7.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)

Mouse FGL2 Monoclonal Antibody | anti-FGL2 antibody

FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49)

Gene Names
FGL2; T49; pT49
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FGL2, Antibody; FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49); Anti -FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49); anti-FGL2 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D9
Specificity
Recognizes human FGL2. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Applicable Applications for anti-FGL2 antibody
ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Application Notes
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml
Immunogen
Partial recombinant corresponding to aa24-123 from human FGL2 (NP_006673) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA14772_WB7.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in PC-12.)

product-image-AAA14772_WB6.jpg WB (Western Blot) (FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in PC-12.)

Application Data

(Detection limit for recombinant GST tagged FGL2 is ~0.1ng/ml as a capture antibody.)

product-image-AAA14772_APP5.jpg Application Data (Detection limit for recombinant GST tagged FGL2 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of FGL2 transfected lysate using FGL2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGL2 rabbit polyclonal antibody.)

product-image-AAA14772_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of FGL2 transfected lysate using FGL2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGL2 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml].)

product-image-AAA14772_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody Lane 1: FGL2 transfected lysate (50kD).Lane 2: Non-transfected lysate.)

product-image-AAA14772_WB2.jpg WB (Western Blot) (Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody Lane 1: FGL2 transfected lysate (50kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)

product-image-AAA14772_WB.jpg WB (Western Blot) (FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)
Related Product Information for anti-FGL2 antibody
May play a role in physiologic lymphocyte functions at mucosal sites.
Product Categories/Family for anti-FGL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,229 Da
NCBI Official Full Name
fibroleukin
NCBI Official Synonym Full Names
fibrinogen-like 2
NCBI Official Symbol
FGL2
NCBI Official Synonym Symbols
T49; pT49
NCBI Protein Information
fibroleukin; fibrinogen-like protein 2
UniProt Protein Name
Fibroleukin
UniProt Gene Name
FGL2
UniProt Entry Name
FGL2_HUMAN

Similar Products

Product Notes

The FGL2 fgl2 (Catalog #AAA14772) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGL2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml. Researchers should empirically determine the suitability of the FGL2 fgl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NNETEEIKDE RAKDVCPVRL ESRGKCEEAG ECPYQVSLPP LTIQLPKQFS RIEEVFKEVQ NLKEIVNSLK KSCQDCKLQA DDNGDPGRNG LLLPSTGAPG. It is sometimes possible for the material contained within the vial of "FGL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.