Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26292_WB6.jpg WB (Western Blot) (FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7 (Cat # L024V1).)

Mouse FGR Monoclonal Antibody | anti-FGR antibody

FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (FITC)

Average rating 0.0
No ratings yet
Gene Names
FGR; SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FGR, Antibody; FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (FITC); Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog; FLJ43153; MGC75096; SRC2; c-fgr; c-src2; p55c-fgr; p58c-fgr; anti-FGR antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B11
Specificity
Recognizes FGR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
529
Applicable Applications for anti-FGR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7 (Cat # L024V1).)

product-image-AAA26292_WB6.jpg WB (Western Blot) (FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12 (Cat # L012V1).)

product-image-AAA26292_WB5.jpg WB (Western Blot) (FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12 (Cat # L012V1).)

Application Data

(Detection limit for recombinant GST tagged FGR is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26292_APP4.jpg Application Data (Detection limit for recombinant GST tagged FGR is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa (Cat # L013V1).)

product-image-AAA26292_WB3.jpg WB (Western Blot) (FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa (Cat # L013V1).)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml])

product-image-AAA26292_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml])

product-image-AAA26292_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml])
Related Product Information for anti-FGR antibody
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
Product Categories/Family for anti-FGR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
NCBI Official Synonym Full Names
FGR proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FGR
NCBI Official Synonym Symbols
SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
NCBI Protein Information
tyrosine-protein kinase Fgr

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGR (Catalog #AAA26292) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FGR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.