Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25688_APP6.jpg Application Data (Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.)

Mouse Fibroblast Growth Factor 8 Monoclonal Antibody | anti-FGF8 antibody

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (PE)

Gene Names
FGF8; HH6; AIGF; KAL6; FGF-8; HBGF-8
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Fibroblast Growth Factor 8, Antibody; Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (PE); anti-FGF8 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A10
Specificity
Recognizes human FGF8. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FGF8 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.)

product-image-AAA25688_APP6.jpg Application Data (Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.)

product-image-AAA25688_WB5.jpg WB (Western Blot) (FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.)

WB (Western Blot)

(FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.)

product-image-AAA25688_WB4.jpg WB (Western Blot) (FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.)

WB (Western Blot)

(FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.)

product-image-AAA25688_WB3.jpg WB (Western Blot) (FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.)

WB (Western Blot)

(FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.)

product-image-AAA25688_WB2.jpg WB (Western Blot) (FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.)

WB (Western Blot)

(FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.)

product-image-AAA25688_WB.jpg WB (Western Blot) (FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.)
Related Product Information for anti-FGF8 antibody
Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.
Product Categories/Family for anti-FGF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
fibroblast growth factor 8 isoform E
NCBI Official Synonym Full Names
fibroblast growth factor 8
NCBI Official Symbol
FGF8
NCBI Official Synonym Symbols
HH6; AIGF; KAL6; FGF-8; HBGF-8
NCBI Protein Information
fibroblast growth factor 8
UniProt Protein Name
Fibroblast growth factor 8
UniProt Gene Name
FGF8
UniProt Synonym Gene Names
AIGF; FGF-8; AIGF; HBGF-8
UniProt Entry Name
FGF8_HUMAN

Similar Products

Product Notes

The FGF8 fgf8 (Catalog #AAA25688) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fibroblast Growth Factor 8 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF8 fgf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fibroblast Growth Factor 8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.