Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26671_APP6.jpg Application Data (Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.)

Mouse GLUD2 Monoclonal Antibody | anti-GLUD2 antibody

GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1) (PE)

Gene Names
GLUD2; GDH2; GLUDP1
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
GLUD2, Antibody; GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1) (PE); Glutamate Dehydrogenase 2; GDH2; GLUDP1; anti-GLUD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C2
Specificity
Recognizes GLUD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
264
Applicable Applications for anti-GLUD2 antibody
IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GLUD2 (AAH05111.1, 1aa-264aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.)

product-image-AAA26671_APP6.jpg Application Data (Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.)

WB (Western Blot)

(GLUD2 monoclonal antibody (M01), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.)

product-image-AAA26671_WB5.jpg WB (Western Blot) (GLUD2 monoclonal antibody (M01), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml])

product-image-AAA26671_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml])

product-image-AAA26671_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml])

IP (Immunoprecipitation)

(Immunoprecipitation of GLUD2 transfected lysate using anti-GLUD2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GLUD2 MaxPab rabbit polyclonal antibody.)

product-image-AAA26671_IP2.jpg IP (Immunoprecipitation) (Immunoprecipitation of GLUD2 transfected lysate using anti-GLUD2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GLUD2 MaxPab rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 monoclonal antibody (M01), clone 3C2.Lane 1: GLUD2 transfected lysate (61 KDa).Lane 2: Non-transfected lysate.)

product-image-AAA26671_WB.jpg WB (Western Blot) (Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 monoclonal antibody (M01), clone 3C2.Lane 1: GLUD2 transfected lysate (61 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GLUD2 antibody
Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130). [supplied by OMIM]
Product Categories/Family for anti-GLUD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
GLUD2 protein
NCBI Official Synonym Full Names
glutamate dehydrogenase 2
NCBI Official Symbol
GLUD2
NCBI Official Synonym Symbols
GDH2; GLUDP1
NCBI Protein Information
glutamate dehydrogenase 2, mitochondrial

Similar Products

Product Notes

The GLUD2 (Catalog #AAA26671) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GLUD2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLUD2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLUD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.