Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26559_WB6.jpg WB (Western Blot) (Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate (42.1 KDa).Lane 2: Non-transfected lysate.)

Mouse GLUL Monoclonal Antibody | anti-GLUL antibody

GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase), GLNS, GS, PIG43, PIG59) (PE)

Average rating 0.0
No ratings yet
Gene Names
GLUL; GS; GLNS; PIG43; PIG59
Applications
Western Blot
Purity
Purified
Synonyms
GLUL, Antibody; GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase), GLNS, GS, PIG43, PIG59) (PE); Glutamate-Ammonia Ligase (Glutamine Synthetase); GLNS; GS; PIG43; PIG59; anti-GLUL antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B6
Specificity
Recognizes GLUL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GLUL antibody
WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GLUL (NP_002056, 274aa-373aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate (42.1 KDa).Lane 2: Non-transfected lysate.)

product-image-AAA26559_WB6.jpg WB (Western Blot) (Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate (42.1 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7 (Cat # L024V1).)

product-image-AAA26559_WB5.jpg WB (Western Blot) (GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12 (Cat # L012V1).)

product-image-AAA26559_WB4.jpg WB (Western Blot) (GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12 (Cat # L012V1).)

Application Data

(Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.)

product-image-AAA26559_APP3.jpg Application Data (Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2 (Cat # L019V1).)

product-image-AAA26559_WB2.jpg WB (Western Blot) (GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2 (Cat # L019V1).)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat (Cat # L017V1).)

product-image-AAA26559_WB.jpg WB (Western Blot) (GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat (Cat # L017V1).)
Related Product Information for anti-GLUL antibody
Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]). [supplied by OMIM]
Product Categories/Family for anti-GLUL antibody
References
1. Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol. Herbert MK, Kuiperij HB, Verbeek MM.J Immunol Methods. 2012 Apr 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
glutamine synthetase
NCBI Official Synonym Full Names
glutamate-ammonia ligase
NCBI Official Symbol
GLUL
NCBI Official Synonym Symbols
GS; GLNS; PIG43; PIG59
NCBI Protein Information
glutamine synthetase
UniProt Protein Name
Glutamine synthetase
UniProt Gene Name
GLUL
UniProt Synonym Gene Names
GLNS; GS
UniProt Entry Name
GLNA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GLUL glul (Catalog #AAA26559) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GLUL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLUL glul for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLUL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.