Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26198_APP6.jpg Application Data (Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.)

Mouse HDAC1 Monoclonal Antibody | anti-HDAC1 antibody

HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
HDAC1; HD1; RPD3; KDAC1; GON-10; RPD3L1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HDAC1, Antibody; HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (Biotin); Histone Deacetylase 1; DKFZp686H12203; GON-10; HD1; RPD3; RPD3L1; anti-HDAC1 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
30
Specificity
Recognizes HDAC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
482
Applicable Applications for anti-HDAC1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HDAC1 (AAH00301, 1aa-482aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26198_APP6.jpg Application Data (Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(HDAC1 monoclonal antibody (M02), clone 3E1 Western Blot analysis of HDAC1 expression in Hela S3 NE.)

product-image-AAA26198_WB5.jpg WB (Western Blot) (HDAC1 monoclonal antibody (M02), clone 3E1 Western Blot analysis of HDAC1 expression in Hela S3 NE.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26198_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26198_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

product-image-AAA26198_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

product-image-AAA26198_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Related Product Information for anti-HDAC1 antibody
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq]
Product Categories/Family for anti-HDAC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Histone deacetylase 1
NCBI Official Synonym Full Names
histone deacetylase 1
NCBI Official Symbol
HDAC1
NCBI Official Synonym Symbols
HD1; RPD3; KDAC1; GON-10; RPD3L1
NCBI Protein Information
histone deacetylase 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HDAC1 (Catalog #AAA26198) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HDAC1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDAC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDAC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.