IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug HDAC2 antibody (AAA282769). Western blot was performed from the immunoprecipitate using HDAC2 antibody (AAA282769) at a dilution of 1:1000.)
Rabbit anti-Human HDAC2 Monoclonal Antibody | anti-HDAC2 antibody
HDAC2 Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
HDAC2, Antibody; HDAC2 Rabbit mAb; HD2; RPD3; YAF1; KDAC2; HDAC2; anti-HDAC2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED
Applicable Applications for anti-HDAC2 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug HDAC2 antibody (AAA282769). Western blot was performed from the immunoprecipitate using HDAC2 antibody (AAA282769) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug HDAC2 antibody (AAA282769). Western blot was performed from the immunoprecipitate using HDAC2 antibody (AAA282769) at a dilution of 1:1000.)
WB (Western Blot)
(Western blot analysis of various lysates using HDAC2 Rabbit mAb (AAA282769) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of various lysates using HDAC2 Rabbit mAb (AAA282769) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-HDAC2 antibody
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-HDAC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 55kDa
Observed MW: 60kDa
Observed MW: 60kDa
UniProt Protein Name
Histone deacetylase 2
UniProt Gene Name
HDAC2
UniProt Synonym Gene Names
HD2
UniProt Entry Name
HDAC2_HUMAN
Similar Products
Product Notes
The HDAC2 hdac2 (Catalog #AAA282769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the HDAC2 hdac2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAYSQGGGKK KVCYYYDGDI GNYYYGQGHP MKPHRIRMTH NLLLNYGLYR KMEIYRPHKA TAEEMTKYHS DEYIKFLRSI RPDNMSEYSK QMQRFNVGED. It is sometimes possible for the material contained within the vial of "HDAC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.