Mouse anti-Human HIP1 Monoclonal Antibody | anti-HIP1 antibody

HIP1 (Huntingtin-interacting Protein 1, Huntingtin-interacting Protein I, MGC126506) (FITC)

Cat. Num. AAA25125

• Gene Names: HIP1; SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIP1, Antibody; HIP1 (Huntingtin-interacting Protein 1, Huntingtin-interacting Protein I, MGC126506) (FITC); anti-HIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F12
• Specificity: Recognizes human HIP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-HIP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa928-1037 from human HIP1 (NP_005329) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged HIP1 is ~0.3ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of HIP1 transfected lysate using HIP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HIP1 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of HIP1 expression in transfected 293T cell line by HIP1 monoclonal antibody Lane 1: HIP1 transfected lysate (116.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(HIP1 monoclonal antibody Western Blot analysis of HIP1 expression in HeLa)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

Product Categories/Family for anti-HIP1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 206729937
• NCBI GeneID: 3092
• NCBI Accession #: NP_005329
• NCBI GenBank Nucleotide #: NM_005338
• UniProt Accession #: O00291
• Molecular Weight: 114kDa
• NCBI Official Full Name: Huntingtin-interacting protein 1
• NCBI Official Synonym Full Names: huntingtin interacting protein 1
• NCBI Official Symbol: HIP1
• NCBI Official Synonym Symbols: SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
• NCBI Protein Information: huntingtin-interacting protein 1
• UniProt Protein Name: Huntingtin-interacting protein 1
• UniProt Gene Name: HIP1
• UniProt Synonym Gene Names: HIP-1; HIP-I
• UniProt Entry Name: HIP1_HUMAN