Rabbit anti-Human HLA-DQA1 Monoclonal Antibody | anti-HLA-DQA1 antibody

HLA-DQA1 Rabbit mAb

Cat. Num. AAA28454

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, ELISA
• Purity: Affinity purification
• Synonyms: HLA-DQA1, Antibody; HLA-DQA1 Rabbit mAb; DQA1; DQ-A1; CELIAC1; HLA-DQA; HLA-DQB1; HLA-DQA1*; HLA-DQA1; anti-HLA-DQA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: EGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL

• Applicable Applications for anti-HLA-DQA1 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
• Application Notes: WB: 1:1000-1:6000; IHC-P: 1:200-1:2000; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HLA-DQA1 (P01909).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using HLA-DQA1 Rabbit mAb (AAA28454) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-HLA-DQA1 antibody

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.

Product Categories/Family for anti-HLA-DQA1 antibody

Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 122188
• NCBI GeneID: 3117
• UniProt Accession #: P01909; O19630; O19706; P01907; P01908; P04225; P04226; P05536; P79553; Q06751; Q29876; Q29994
• Molecular Weight: Calculated MW: 28kDa; Observed MW: 28kDa
• UniProt Protein Name: HLA class II histocompatibility antigen, DQ alpha 1 chain
• UniProt Gene Name: HLA-DQA1
• UniProt Entry Name: DQA1_HUMAN