Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282665_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug HNF3?/FOXA2 antibody (AAA282665). Western blot was performed from the immunoprecipitate using HNF3?/FOXA2 antibody (AAA282665) at a dilution of 1:1000.)

Rabbit anti-Human HNF3beta/FOXA2 Monoclonal Antibody | anti-FOXA2 antibody

HNF3beta/FOXA2 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
HNF3beta/FOXA2, Antibody; HNF3beta/FOXA2 Rabbit mAb; HNF3B; TCF3B; HNF-3-beta; HNF3beta/FOXA2; anti-FOXA2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA
Applicable Applications for anti-FOXA2 antibody
ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Human, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HNF3beta/FOXA2 (Q9Y261).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug HNF3?/FOXA2 antibody (AAA282665). Western blot was performed from the immunoprecipitate using HNF3?/FOXA2 antibody (AAA282665) at a dilution of 1:1000.)

product-image-AAA282665_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug HNF3?/FOXA2 antibody (AAA282665). Western blot was performed from the immunoprecipitate using HNF3?/FOXA2 antibody (AAA282665) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of Hep G2 cells using HNF3?/FOXA2 Rabbit mAb (AAA282665,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA282665_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of Hep G2 cells using HNF3?/FOXA2 Rabbit mAb (AAA282665,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using HNF3?/FOXA2 Rabbit mAb (AAA282665) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA282665_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using HNF3?/FOXA2 Rabbit mAb (AAA282665) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-FOXA2 antibody
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 48kDa
Observed MW: 52kDa
UniProt Protein Name
Hepatocyte nuclear factor 3-beta
UniProt Gene Name
FOXA2
UniProt Synonym Gene Names
HNF3B; TCF3B; HNF-3-beta; HNF-3B; TCF-3B
UniProt Entry Name
FOXA2_HUMAN

Similar Products

Product Notes

The FOXA2 foxa2 (Catalog #AAA282665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNF3beta/FOXA2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HNF3beta/FOXA2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the FOXA2 foxa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLGAVKMEGH EPSDWSSYYA EPEGYSSVSN MNAGLGMNGM NTYMSMSAAA MGSGSGNMSA GSMNMSSYVG AGMSPSLAGM SPGAGAMAGM GGSAGAAGVA. It is sometimes possible for the material contained within the vial of "HNF3beta/FOXA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.