Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282945_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1? Rabbit mAb (AAA282945, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit anti-Mouse IL1beta Monoclonal Antibody | anti-Il1b antibody

IL1beta Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Mouse
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
IL1beta, Antibody; IL1beta Rabbit mAb; Il-1b; IL-1beta; IL1beta; anti-Il1b antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Applicable Applications for anti-Il1b antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 118-269 of mouse IL1beta (NP_032387.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1? Rabbit mAb (AAA282945, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA282945_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1? Rabbit mAb (AAA282945, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of lysates from RAW 264.7 cells using IL1? Rabbit mAb (AAA282945) at 1:1000 dilution incubated overnight at 4?. Raw264.7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA282945_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from RAW 264.7 cells using IL1? Rabbit mAb (AAA282945) at 1:1000 dilution incubated overnight at 4?. Raw264.7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of Recombinant Mouse IL-1 beta Protein (RP01340), using IL1? Rabbit mAb (AAA282945) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 10ng/5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)

product-image-AAA282945_WB15.jpg WB (Western Blot) (Western blot analysis of Recombinant Mouse IL-1 beta Protein (RP01340), using IL1? Rabbit mAb (AAA282945) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 10ng/5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)
Related Product Information for anti-Il1b antibody
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 31kDa
Observed MW: 19kDa/17/31kDa
UniProt Protein Name
Interleukin-1 beta
UniProt Gene Name
Il1b
UniProt Synonym Gene Names
IL-1 beta
UniProt Entry Name
IL1B_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Il1b il1b (Catalog #AAA282945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL1beta Rabbit mAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL1beta can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the Il1b il1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPIRQLHYRL RDEQQKSLVL SDPYELKALH LNGQNINQQV IFSMSFVQGE PSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKSKV EFESAEFPNW YISTSQAEHK PVFLGNNSGQ DIIDFTMESV SS. It is sometimes possible for the material contained within the vial of "IL1beta, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.