Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24541_WB7.jpg WB (Western Blot) (Western blot analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse ILK Monoclonal Antibody | anti-ILK antibody

ILK (Integrin-linked Protein Kinase, 59kD Serine/Threonine-protein Kinase, ILK-1, ILK-2, p59ILK, ILK1, ILK2, DKFZp686F1765) APC

Gene Names
ILK; P59; ILK-1; ILK-2; p59ILK; HEL-S-28
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ILK, Antibody; ILK (Integrin-linked Protein Kinase, 59kD Serine/Threonine-protein Kinase, ILK-1, ILK-2, p59ILK, ILK1, ILK2, DKFZp686F1765) APC; anti-ILK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F10
Specificity
Recognizes human ILK. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ILK antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa341-452 from human ILK (AAH01554) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24541_WB7.jpg WB (Western Blot) (Western blot analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in NIH/3T3.)

product-image-AAA24541_WB6.jpg WB (Western Blot) (ILK monoclonal antibody. Western Blot analysis of ILK expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged ILK is ~3ng/ml as a capture antibody.)

product-image-AAA24541_APP5.jpg Application Data (Detection limit for recombinant GST tagged ILK is ~3ng/ml as a capture antibody.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in HepG2.)

product-image-AAA24541_WB4.jpg WB (Western Blot) (ILK monoclonal antibody. Western Blot analysis of ILK expression in HepG2.)

WB (Western Blot)

(ILK monoclonal antibody. Western Blot analysis of ILK expression in PC-12.)

product-image-AAA24541_WB3.jpg WB (Western Blot) (ILK monoclonal antibody. Western Blot analysis of ILK expression in PC-12.)

WB (Western Blot)

(ILK monoclonal antibody Western Blot analysis of ILK expression in HeLa.)

product-image-AAA24541_WB2.jpg WB (Western Blot) (ILK monoclonal antibody Western Blot analysis of ILK expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.06kD).)

product-image-AAA24541_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.06kD).)
Related Product Information for anti-ILK antibody
Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.
Product Categories/Family for anti-ILK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36,467 Da
NCBI Official Full Name
Homo sapiens integrin-linked kinase, mRNA
NCBI Official Synonym Full Names
integrin linked kinase
NCBI Official Symbol
ILK
NCBI Official Synonym Symbols
P59; ILK-1; ILK-2; p59ILK; HEL-S-28
NCBI Protein Information
integrin-linked protein kinase

Similar Products

Product Notes

The ILK (Catalog #AAA24541) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ILK (Integrin-linked Protein Kinase, 59kD Serine/Threonine-protein Kinase, ILK-1, ILK-2, p59ILK, ILK1, ILK2, DKFZp686F1765) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ILK can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ILK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ILK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.