Mouse IRX3 Monoclonal Antibody | anti-IRX3 antibody

IRX3 (Iroquois Homeobox 3, IRX-1) (HRP)

Cat. Num. AAA26468

• Gene Names: IRX3; IRX-1; IRXB1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: IRX3, Antibody; IRX3 (Iroquois Homeobox 3, IRX-1) (HRP); Iroquois Homeobox 3; IRX-1; anti-IRX3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D7
• Specificity: Recognizes IRX3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-IRX3 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IRX3 (NP_077312, 182aa-285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(IRX3 monoclonal antibody (M05), clone 1D7. Western Blot analysis of IRX3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(IRX3 monoclonal antibody (M05), clone 1D7. Western Blot analysis of IRX3 expression in NIH/3T3 (Cat # L018V1).)

Application Data

(Detection limit for recombinant GST tagged IRX3 is approximately 1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(IRX3 monoclonal antibody (M05), clone 1D7 Western Blot analysis of IRX3 expression in Hela S3 NE (Cat # L013V3).)

Product Categories/Family for anti-IRX3 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 226371735
• NCBI GeneID: 79191
• NCBI Accession #: NP_077312
• NCBI GenBank Nucleotide #: NM_024336
• UniProt Accession #: P78415
• Molecular Weight: 52kDa
• NCBI Official Full Name: iroquois-class homeodomain protein IRX-3
• NCBI Official Synonym Full Names: iroquois homeobox 3
• NCBI Official Symbol: IRX3
• NCBI Official Synonym Symbols: IRX-1; IRXB1
• NCBI Protein Information: iroquois-class homeodomain protein IRX-3
• UniProt Protein Name: Iroquois-class homeodomain protein IRX-3
• UniProt Gene Name: IRX3
• UniProt Synonym Gene Names: IRXB1
• UniProt Entry Name: IRX3_HUMAN