Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28593_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse spleen tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit anti-Human Ki67 Monoclonal Antibody | anti-MKI67 antibody

[KO Validated] Ki67 Rabbit PolymAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
Ki67, Antibody; [KO Validated] Ki67 Rabbit PolymAb; KIA; MIB-; MIB-1; PPP1R105; anti-MKI67 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVE
Applicable Applications for anti-MKI67 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:1000-1:6000
IHC-P: 1:1000-1:4000
IF/ICC: 1:200-1:2000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2271-2370 of human Ki67 (NP_002408.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse spleen tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA28593_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse spleen tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of PC-12 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28593_ICC12.jpg ICC (Immunocytochemistry) (Confocal imaging of PC-12 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28593_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of A-431 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28593_ICC10.jpg ICC (Immunocytochemistry) (Confocal imaging of A-431 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of C2C12 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28593_ICC9.jpg ICC (Immunocytochemistry) (Confocal imaging of C2C12 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28593_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from RAW264.7 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA28593_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from RAW264.7 cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and Ki67 knockout (KO) HeLa cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at 1:1000 dilution incubated overnight at 4?. HeLa cells and Ki67 knockout (KO) HeLa cells were treated by Nocodazole (1 ug/mL) at 37? for 24 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28593_WB.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and Ki67 knockout (KO) HeLa cells using [KO Validated] Ki67 Rabbit PolymAb® (AAA28593) at 1:1000 dilution incubated overnight at 4?. HeLa cells and Ki67 knockout (KO) HeLa cells were treated by Nocodazole (1 ug/mL) at 37? for 24 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-MKI67 antibody
Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 350kDa/359kDa
Observed MW: 359kDa/359kDa??
UniProt Protein Name
Antigen KI-67
UniProt Gene Name
MKI67
UniProt Entry Name
KI67_HUMAN

Similar Products

Product Notes

The MKI67 mki67 (Catalog #AAA28593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Ki67 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ki67 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:1000-1:6000 IHC-P: 1:1000-1:4000 IF/ICC: 1:200-1:2000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the MKI67 mki67 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAGGDEKDMK AFMGTPVQKL DLPGNLPGSK RWPQTPKEKA QALEDLAGFK ELFQTPGTDK PTTDEKTTKI ACKSPQPDPV DTPASTKQRP KRNLRKADVE. It is sometimes possible for the material contained within the vial of "Ki67, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.