Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25144_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (70kD).)

Mouse anti-Human LEF1 Monoclonal Antibody | anti-LEF1 antibody

LEF1 (Lymphoid Enhancer-binding Factor 1, T Cell-specific Transcription Factor 1-alpha, DKFZp586H0919) (FITC)

Average rating 0.0
No ratings yet
Gene Names
LEF1; LEF-1; TCF10; TCF7L3; TCF1ALPHA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LEF1, Antibody; LEF1 (Lymphoid Enhancer-binding Factor 1, T Cell-specific Transcription Factor 1-alpha, DKFZp586H0919) (FITC); anti-LEF1 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H5
Specificity
Recognizes human LEF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LEF1 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-400 from human LEF1 (AAH50632) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (70kD).)

product-image-AAA25144_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (70kD).)

WB (Western Blot)

(Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25144_WB5.jpg WB (Western Blot) (Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged LEF1 is ~0.3ng/ml as a capture antibody.)

product-image-AAA25144_APP4.jpg Application Data (Detection limit for recombinant GST tagged LEF1 is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody. Lane 1: LEF1 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)

product-image-AAA25144_WB3.jpg WB (Western Blot) (Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody. Lane 1: LEF1 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(LEF1 monoclonal antibody, Western Blot analysis of LEF1 expression in MES-SA/Dx5.)

product-image-AAA25144_WB2.jpg WB (Western Blot) (LEF1 monoclonal antibody, Western Blot analysis of LEF1 expression in MES-SA/Dx5.)

WB (Western Blot)

(LEF1 monoclonal antibody. Western Blot analysis of LEF1 expression in HL-60.)

product-image-AAA25144_WB.jpg WB (Western Blot) (LEF1 monoclonal antibody. Western Blot analysis of LEF1 expression in HL-60.)
Related Product Information for anti-LEF1 antibody
This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-LEF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34,103 Da
NCBI Official Full Name
Homo sapiens lymphoid enhancer-binding factor 1, mRNA
NCBI Official Synonym Full Names
lymphoid enhancer binding factor 1
NCBI Official Symbol
LEF1
NCBI Official Synonym Symbols
LEF-1; TCF10; TCF7L3; TCF1ALPHA
NCBI Protein Information
lymphoid enhancer-binding factor 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LEF1 (Catalog #AAA25144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LEF1 (Lymphoid Enhancer-binding Factor 1, T Cell-specific Transcription Factor 1-alpha, DKFZp586H0919) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LEF1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LEF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LEF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.