Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24851_WB6.jpg WB (Western Blot) (Western Blot analysis of LYPLA3 expression in NIH/3T3)

Mouse LYPLA3 Monoclonal Antibody | anti-LYPLA3 antibody

LYPLA3 (PLA2G15, Group XV Phospholipase A2, 1-O-acylceramide Synthase, ACS, LCAT-like Lysophospholipase, LLPL, Lysophospholipase 3, Lysosomal Phospholipase A2, LPLA2, UNQ341/PRO540) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
PLA2G15; ACS; LLPL; LPLA2; LYPLA3; GXVPLA2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LYPLA3, Antibody; LYPLA3 (PLA2G15, Group XV Phospholipase A2, 1-O-acylceramide Synthase, ACS, LCAT-like Lysophospholipase, LLPL, Lysophospholipase 3, Lysosomal Phospholipase A2, LPLA2, UNQ341/PRO540) (Biotin); anti-LYPLA3 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B11
Specificity
Recognizes human LYPLA3. Species Crossreactivity: mouse and rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Applicable Applications for anti-LYPLA3 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa314-412 from human LYPLA3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of LYPLA3 expression in NIH/3T3)

product-image-AAA24851_WB6.jpg WB (Western Blot) (Western Blot analysis of LYPLA3 expression in NIH/3T3)

WB (Western Blot)

(Western Blot analysis of PLA2G15 expression in transfected 293T cell line)

product-image-AAA24851_WB5.jpg WB (Western Blot) (Western Blot analysis of PLA2G15 expression in transfected 293T cell line)

WB (Western Blot)

(Western Blot analysis of LYPLA3 expression in Raw 264.7)

product-image-AAA24851_WB4.jpg WB (Western Blot) (Western Blot analysis of LYPLA3 expression in Raw 264.7)

WB (Western Blot)

(Western Blot analysis of LYPLA3 expression in PC-12)

product-image-AAA24851_WB3.jpg WB (Western Blot) (Western Blot analysis of LYPLA3 expression in PC-12)

WB (Western Blot)

(Western Blot analysis of LYPLA3 expression in HeLa)

product-image-AAA24851_WB2.jpg WB (Western Blot) (Western Blot analysis of LYPLA3 expression in HeLa)

WB (Western Blot)

(Western Blot detection against Immunogen using (37kD).)

product-image-AAA24851_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen using (37kD).)
Related Product Information for anti-LYPLA3 antibody
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities.
Product Categories/Family for anti-LYPLA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,717 Da
NCBI Official Full Name
group XV phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group XV
NCBI Official Symbol
PLA2G15
NCBI Official Synonym Symbols
ACS; LLPL; LPLA2; LYPLA3; GXVPLA2
NCBI Protein Information
group XV phospholipase A2; 1-O-acylceramide synthase; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2)
UniProt Protein Name
Group XV phospholipase A2
UniProt Gene Name
PLA2G15
UniProt Synonym Gene Names
LYPLA3; ACS; LLPL; LPLA2
UniProt Entry Name
PAG15_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LYPLA3 pla2g15 (Catalog #AAA24851) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LYPLA3 (PLA2G15, Group XV Phospholipase A2, 1-O-acylceramide Synthase, ACS, LCAT-like Lysophospholipase, LLPL, Lysophospholipase 3, Lysosomal Phospholipase A2, LPLA2, UNQ341/PRO540) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LYPLA3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LYPLA3 pla2g15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LYPLA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.