Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25149_WB6.jpg WB (Western Blot) (LZTFL1 monoclonal antibody, Western Blot analysis of LZTFL1 expression in HeLa.)

Mouse anti-Human LZTFL1 Monoclonal Antibody | anti-LZTFL1 antibody

LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (FITC)

Gene Names
LZTFL1; BBS17
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LZTFL1, Antibody; LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (FITC); anti-LZTFL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7F6
Specificity
Recognizes human LZTFL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LZTFL1 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 25ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa200-300 from human LZTFL1 (NP_065080) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(LZTFL1 monoclonal antibody, Western Blot analysis of LZTFL1 expression in HeLa.)

product-image-AAA25149_WB6.jpg WB (Western Blot) (LZTFL1 monoclonal antibody, Western Blot analysis of LZTFL1 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25149_APP5.jpg Application Data (Detection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoDetection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.clonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25ug/ml].)

product-image-AAA25149_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoDetection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.clonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

product-image-AAA25149_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody. Lane 1: LZTFL1 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.)

product-image-AAA25149_WB2.jpg WB (Western Blot) (Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody. Lane 1: LZTFL1 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA25149_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-LZTFL1 antibody
References
1. A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened. Seo S, Zhang Q, Bugge K, Breslow DK, Searby CC, Nachury MV, Sheffield VC.PLoS Genet. 2011 Nov;7(11):e1002358. Epub 2011 Nov 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.0kDa (322aa) confirmed by MALDI-TOF
NCBI Official Full Name
leucine zipper transcription factor-like protein 1 isoform 1
NCBI Official Synonym Full Names
leucine zipper transcription factor like 1
NCBI Official Symbol
LZTFL1
NCBI Official Synonym Symbols
BBS17
NCBI Protein Information
leucine zipper transcription factor-like protein 1
UniProt Protein Name
Leucine zipper transcription factor-like protein 1
UniProt Gene Name
LZTFL1
UniProt Entry Name
LZTL1_HUMAN

Similar Products

Product Notes

The LZTFL1 lztfl1 (Catalog #AAA25149) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LZTFL1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LZTFL1 lztfl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LZTFL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.