IP (Immunoprecipitation)
(Immunoprecipitation of CT55-mCherry from 300 ug extracts of 293F cells transfected with a CT55 expression vector containing a single C-terminal mCherry-Tag was performed using 3 ug of mCherry-Tag Rabbit mAb (AAA283344). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10 % of the total input. Western blot analysis of immunoprecipitates was conducted using mCherry-Tag Rabbit mAb (AAA283344) at a dilution of 1:6000.)
Rabbit anti-Discosoma mCherry-Tag Monoclonal Antibody | anti-mCherry antibody
Rabbit anti mCherry-Tag mAb
Reactivity
Discosoma
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
mCherry-Tag, Antibody; Rabbit anti mCherry-Tag mAb; mCherry; mCherry tag; mCherry-tag; anti-mCherry antibody
Host
Rabbit
Reactivity
Discosoma
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Applicable Applications for anti-mCherry antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Species independent
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of Discosoma MCherry fluorescent proteinm.
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of CT55-mCherry from 300 ug extracts of 293F cells transfected with a CT55 expression vector containing a single C-terminal mCherry-Tag was performed using 3 ug of mCherry-Tag Rabbit mAb (AAA283344). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10 % of the total input. Western blot analysis of immunoprecipitates was conducted using mCherry-Tag Rabbit mAb (AAA283344) at a dilution of 1:6000.)
IP (Immunoprecipitation)
(Immunoprecipitation of CT55-mCherry from 300 ug extracts of 293F cells transfected with a CT55 expression vector containing a single C-terminal mCherry-Tag was performed using 3 ug of mCherry-Tag Rabbit mAb (AAA283344). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10 % of the total input. Western blot analysis of immunoprecipitates was conducted using mCherry-Tag Rabbit mAb (AAA283344) at a dilution of 1:6000.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293F cells transfected with mCherry using Rabbit anti mCherry-Tag mAb (AAA283344) at 1:20000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 20 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293F cells transfected with mCherry using Rabbit anti mCherry-Tag mAb (AAA283344) at 1:20000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 20 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-mCherry antibody
Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes.Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.
Product Categories/Family for anti-mCherry antibody
Similar Products
Product Notes
The mCherry (Catalog #AAA283344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rabbit anti mCherry-Tag mAb reacts with Discosoma and may cross-react with other species as described in the data sheet. AAA Biotech's mCherry-Tag can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the mCherry for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVSKGEEDNM AIIKEFMRFK VHMEGSVNGH EFEIEGEGEG RPYEGTQTAK LKVTKGGPLP FAWDILSPQF MYGSKAYVKH PADIPDYLKL SFPEGFKWER VMNFEDGGVV TVTQDSSLQD GEFIYKVKLR GTNFPSDGPV MQKKTMGWEA SSERMYPEDG ALKGEIKQRL KLKDGGHYDA EVKTTYKAKK PVQLPGAYNV NIKLDITSHN EDYTIVEQYE RAEGRHSTGG MDELYK. It is sometimes possible for the material contained within the vial of "mCherry-Tag, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.