Rabbit anti-Human MCM3 Monoclonal Antibody | anti-MCM3 antibody

MCM3 Rabbit mAb

Cat. Num. AAA28459

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
• Purity: Affinity purification
• Synonyms: MCM3, Antibody; MCM3 Rabbit mAb; HCC5; P1.h; RLFB; P1-MCM3; MCM3; anti-MCM3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV

• Applicable Applications for anti-MCM3 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
• Application Notes: WB: 1:500-1:1000; IHC-P: 1:50-1:200; IF/ICC: 1:50-1:200; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug MCM3 antibody (AAA28459). Western blot was performed from the immunoprecipitate using MCM3 antibody (AAA28459) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen, using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-MCM3 antibody

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-MCM3 antibody

Epigenetics Nuclear Signaling; Cell Biology Developmental Biology; Cell Cycle; Centrosome; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 19857543
• NCBI GeneID: 4172
• UniProt Accession #: P25205; Q92660; Q9BTR3; Q9NUE7; B4DWW4
• Molecular Weight: Calculated MW: 91kDa; Observed MW: 100kDa
• UniProt Protein Name: DNA replication licensing factor MCM3
• UniProt Gene Name: MCM3
• UniProt Entry Name: MCM3_HUMAN