Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IP (Immunoprecipitation)
>
<
IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug MCM3 antibody (AAA28459). Western blot was performed from the immunoprecipitate using MCM3 antibody (AAA28459) at a dilution of 1:1000.)

Rabbit anti-Human MCM3 Monoclonal Antibody | anti-MCM3 antibody

MCM3 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
MCM3, Antibody; MCM3 Rabbit mAb; HCC5; P1.h; RLFB; P1-MCM3; MCM3; anti-MCM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV
Applicable Applications for anti-MCM3 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug MCM3 antibody (AAA28459). Western blot was performed from the immunoprecipitate using MCM3 antibody (AAA28459) at a dilution of 1:1000.)

IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug MCM3 antibody (AAA28459). Western blot was performed from the immunoprecipitate using MCM3 antibody (AAA28459) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer using MCM3 Rabbit mAb (AAA28459) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen, using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

WB (Western Blot) (Western blot analysis of lysates from Mouse spleen, using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot) (Western blot analysis of various lysates using MCM3 Rabbit mAb (AAA28459) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-MCM3 antibody
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MCM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 91kDa
Observed MW: 100kDa
UniProt Protein Name
DNA replication licensing factor MCM3
UniProt Gene Name
MCM3
UniProt Entry Name
MCM3_HUMAN

Similar Products

MCM3 Antibody

Host: Mouse
Reactivity: n/a
Apps: Western Blot

MCM3 Antibody

Host: Mouse
Reactivity: n/a
Apps: Immunofluorescence, Western Blot

MCM3 Antibody

Host: Rabbit
Reactivity: Human
Apps: ELISA, Western Blot, Immunohistochemistry, Chromatin Immunoprecipitation, Immunoprecipitation

MCM3 Antibody

Host: Mouse
Reactivity: n/a
Apps: Immunofluorescence, Western Blot

MCM3 Antibody

Host: Mouse
Reactivity: n/a
Apps: Immunofluorescence, Western Blot

MCM3 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA

MCM3 Antibody

Host: Mouse
Reactivity: n/a
Apps: Immunofluorescence, Western Blot

MCM3 Antibody

Host: Rabbit
Reactivity: Human, Mouse, Rat
Apps: Western Blot, Immunohistochemistry, Immunocytochemistry

P P38MAPK ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

P-tau217 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

PKCdelta1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Phospho-Syk ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

PKCi Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunocytochemistry, Immunohistochemistry, ELISA

P-JNK/SAPK ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

ptau ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

PRKCE ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

MLKL Antibody

Host: Mouse
Reactivity: Human
Apps: Immunohistochemistry, Immunofluorescence

PRKCA ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

P-TDP43 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Phospho Tau (P181) ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Product Notes

The MCM3 mcm3 (Catalog #AAA28459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCM3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA). WB: 1:500-1:1000 IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the MCM3 mcm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGTVVLDDV ELREAQRDYL DFLDDEEDQG IYQSKVRELI SDNQYRLIVN VNDLRRKNEK RANRLLNNAF EELVAFQRAL KDFVASIDAT YAKQYEEFYV. It is sometimes possible for the material contained within the vial of "MCM3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
[email protected]

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.