Mouse MTA1 Monoclonal Antibody | anti-MTA1 antibody

MTA1 (Metastasis Associated 1) (APC)

Cat. Num. AAA26045

• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MTA1, Antibody; MTA1 (Metastasis Associated 1) (APC); Metastasis Associated 1; anti-MTA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 4D11
• Specificity: Recognizes MTA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 715

• Applicable Applications for anti-MTA1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MTA1 (NP_004680, 601aa-700aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in PC-12.)

Application Data

(Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in NIH/3T3.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11 Western Blot analysis of MTA1 expression in Hela S3 NE.)

Related Product Information for anti-MTA1 antibody

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq]

Product Categories/Family for anti-MTA1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 115527080
• NCBI GeneID: 9112
• NCBI Accession #: NP_004680
• NCBI GenBank Nucleotide #: NP_004680.2
• UniProt Accession #: Q13330
• NCBI Official Full Name: metastasis-associated protein MTA1 isoform MTA1
• NCBI Official Synonym Full Names: metastasis associated 1
• NCBI Official Symbol: MTA1
• NCBI Protein Information: metastasis-associated protein MTA1
• UniProt Protein Name: Metastasis-associated protein MTA1
• UniProt Gene Name: MTA1
• UniProt Entry Name: MTA1_HUMAN