Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA26577_WB6.jpg WB (Western Blot) (MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in PC-12 (Cat # L012V1).)

Mouse MTA1 Monoclonal Antibody | anti-MTA1 antibody

MTA1 (Metastasis Associated 1) (PE)

Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MTA1, Antibody; MTA1 (Metastasis Associated 1) (PE); Metastasis Associated 1; anti-MTA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4D11
Specificity
Recognizes MTA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
715
Applicable Applications for anti-MTA1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MTA1 (NP_004680, 601aa-700aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in PC-12 (Cat # L012V1).)

product-image-AAA26577_WB6.jpg WB (Western Blot) (MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in PC-12 (Cat # L012V1).)

Application Data

(Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.)

product-image-AAA26577_APP5.jpg Application Data (Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in NIH/3T3 (Cat # L018V1).)

product-image-AAA26577_WB4.jpg WB (Western Blot) (MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in NIH/3T3 (Cat # L018V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26577_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26577_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(MTA1 monoclonal antibody (M02), clone 4D11 Western Blot analysis of MTA1 expression in Hela S3 NE (Cat # L013V3).)

product-image-AAA26577_WB.jpg WB (Western Blot) (MTA1 monoclonal antibody (M02), clone 4D11 Western Blot analysis of MTA1 expression in Hela S3 NE (Cat # L013V3).)
Related Product Information for anti-MTA1 antibody
This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq]
Product Categories/Family for anti-MTA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
metastasis-associated protein MTA1 isoform MTA1
NCBI Official Synonym Full Names
metastasis associated 1
NCBI Official Symbol
MTA1
NCBI Protein Information
metastasis-associated protein MTA1
UniProt Protein Name
Metastasis-associated protein MTA1
UniProt Gene Name
MTA1
UniProt Entry Name
MTA1_HUMAN

Similar Products

Product Notes

The MTA1 mta1 (Catalog #AAA26577) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MTA1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTA1 mta1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.