Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (NEK10 monoclonal antibody, Western Blot analysis of NEK10 expression in HeLa.)

Mouse anti-Human, Mouse NEK10 Monoclonal Antibody | anti-NEK10 antibody

NEK10 (Never in Mitosis A-related Kinase 10, NimA-related Protein Kinase 10, FLJ32685, Serine/Threonine Protein Kinase Nek10, FLJ32685) APC

Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEK10; Monoclonal Antibody; NEK10 (Never in Mitosis A-related Kinase 10; NimA-related Protein Kinase 10; FLJ32685; Serine/Threonine Protein Kinase Nek10; FLJ32685) APC; anti-NEK10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C9
Specificity
Recognizes human NEK10. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1172
Applicable Applications for anti-NEK10 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa211-301 from human NEK10 (NP_68974) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYSEVD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(NEK10 monoclonal antibody, Western Blot analysis of NEK10 expression in HeLa.)

WB (Western Blot) (NEK10 monoclonal antibody, Western Blot analysis of NEK10 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.01kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.01kD).)

Application Data

(Detection limit for recombinant GST tagged NEK10 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged NEK10 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody. Lane 1: NEK10 transfected lysate (53.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody. Lane 1: NEK10 transfected lysate (53.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in NIH/3T3.)

WB (Western Blot) (NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in NIH/3T3.)

WB (Western Blot)

(NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in Raw 264.7.)

WB (Western Blot) (NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in Raw 264.7.)
Product Categories/Family for anti-NEK10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase Nek10 isoform 2
UniProt Protein Name
Serine/threonine-protein kinase Nek10
UniProt Gene Name
NEK10
UniProt Synonym Gene Names
NimA-related protein kinase 10
UniProt Entry Name
NEK10_HUMAN

Similar Products

Product Notes

The NEK10 nek10 (Catalog #AAA24583) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEK10 (Never in Mitosis A-related Kinase 10, NimA-related Protein Kinase 10, FLJ32685, Serine/Threonine Protein Kinase Nek10, FLJ32685) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NEK10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEK10 nek10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEK10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.