Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126949_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of RH35 cells using anti-NIRF antibody (AAA126949).Overlay histogram showing RH35 cells stained with AAA126949 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NIRF Antibody (AAA126949, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse anti-Human, Rat NIRF Monoclonal Antibody | anti-UHRF2 antibody

Anti-NIRF Antibody Picoband (monoclonal, 6B5)

Gene Names
UHRF2; NIRF; URF2; RNF107
Reactivity
Human, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
NIRF, Antibody; Anti-NIRF Antibody Picoband (monoclonal, 6B5); anti-UHRF2 antibody
Ordering
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
6B5
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-UHRF2 antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of RH35 cells using anti-NIRF antibody (AAA126949).Overlay histogram showing RH35 cells stained with AAA126949 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NIRF Antibody (AAA126949, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126949_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of RH35 cells using anti-NIRF antibody (AAA126949).Overlay histogram showing RH35 cells stained with AAA126949 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NIRF Antibody (AAA126949, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of HeLa cells using anti-NIRF antibody (AAA126949).Overlay histogram showing HeLa cells stained with AAA126949 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NIRF Antibody (AAA126949, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126949_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of HeLa cells using anti-NIRF antibody (AAA126949).Overlay histogram showing HeLa cells stained with AAA126949 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NIRF Antibody (AAA126949, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 2. IF analysis of NIRF using anti-NIRF antibody (AAA126949).NIRF was detected in an immunocytochemical section of HeLa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-NIRF Antibody (AAA126949) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126949_IF13.jpg IF (Immunofluorescence) (Figure 2. IF analysis of NIRF using anti-NIRF antibody (AAA126949).NIRF was detected in an immunocytochemical section of HeLa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-NIRF Antibody (AAA126949) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of NIRF using anti-NIRF antibody (AAA126949).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysates,Lane 2: human HT1080 whole cell lysates,Lane 3: human Jurkat whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-NIRF antigen affinity purified monoclonal antibody (#AAA126949) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NIRF at approximately 90 kDa. The expected band size for NIRF is at 90 kDa.)

product-image-AAA126949_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of NIRF using anti-NIRF antibody (AAA126949).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysates,Lane 2: human HT1080 whole cell lysates,Lane 3: human Jurkat whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-NIRF antigen affinity purified monoclonal antibody (#AAA126949) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NIRF at approximately 90 kDa. The expected band size for NIRF is at 90 kDa.)
Related Product Information for anti-UHRF2 antibody
E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Product Categories/Family for anti-UHRF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
56,077 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase UHRF2
NCBI Official Synonym Full Names
ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
NCBI Official Symbol
UHRF2
NCBI Official Synonym Symbols
NIRF; URF2; RNF107
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF2; nuclear protein 97; RING finger protein 107; Np95-like ring finger protein; nuclear zinc finger protein NP97; np95/ICBP90-like RING finger protein; ubiquitin-like, containing PHD and RING finger domains, 2; ubiquitin-lik
UniProt Protein Name
E3 ubiquitin-protein ligase UHRF2
UniProt Gene Name
UHRF2
UniProt Synonym Gene Names
NIRF; RNF107; Np95-like RING finger protein
UniProt Entry Name
UHRF2_HUMAN

Similar Products

Product Notes

The UHRF2 uhrf2 (Catalog #AAA126949) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-NIRF Antibody Picoband (monoclonal, 6B5) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NIRF can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the UHRF2 uhrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NIRF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.