IP (Immunoprecipitation)
(Immunoprecipitation of NLRP3 from 300 ug extracts of RAW 264.7 cells treated by LPS (1 ug/ml, 8h) was performed using 3 ug of NLRP3 Rabbit mAb (AAA283049). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using NLRP3 Rabbit mAb (AAA283049) at a dilution of 1:2000.)
Rabbit anti-Mouse NLRP3 Monoclonal Antibody | anti-Nlrp3 antibody
NLRP3 Rabbit mAb
Reactivity
Mouse
Applications
ELISA, Immunoprecipitation, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NLRP3, Antibody; NLRP3 Rabbit mAb; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; NLRP3; anti-Nlrp3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDR
Applicable Applications for anti-Nlrp3 antibody
ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of NLRP3 from 300 ug extracts of RAW 264.7 cells treated by LPS (1 ug/ml, 8h) was performed using 3 ug of NLRP3 Rabbit mAb (AAA283049). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using NLRP3 Rabbit mAb (AAA283049) at a dilution of 1:2000.)
IP (Immunoprecipitation)
(Immunoprecipitation of NLRP3 from 300 ug extracts of RAW 264.7 cells treated by LPS (1 ug/ml, 8h) was performed using 3 ug of NLRP3 Rabbit mAb (AAA283049). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using NLRP3 Rabbit mAb (AAA283049) at a dilution of 1:2000.)
ICC (Immunocytochemistry)
(Confocal imaging of RAW 264.7 cells (treated with LPS) and RAW 264.7 cells (untreated) using NLRP3 Rabbit mAb (AAA283049, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)
ICC (Immunocytochemistry)
(Confocal imaging of RAW 264.7 cells (treated with LPS) and RAW 264.7 cells (untreated) using NLRP3 Rabbit mAb (AAA283049, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)
WB (Western Blot)
(Western blot analysis of lysates from RAW 264.7 cells, using NLRP3 Rabbit mAb (AAA283049) at 1:1000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of lysates from RAW 264.7 cells, using NLRP3 Rabbit mAb (AAA283049) at 1:1000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-Nlrp3 antibody
Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).
Product Categories/Family for anti-Nlrp3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 118kDa
Observed MW: 110kDa//110KD
Observed MW: 110kDa//110KD
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 3
UniProt Gene Name
Nlrp3
UniProt Synonym Gene Names
Cias1; Mmig1; Nalp3; Pypaf1
UniProt Entry Name
NALP3_MOUSE
Similar Products
Product Notes
The Nlrp3 nlrp3 (Catalog #AAA283049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP3 Rabbit mAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the Nlrp3 nlrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSVRCKLAQ YLEDLEDVDL KKFKMHLEDY PPEKGCIPVP RGQMEKADHL DLATLMIDFN GEEKAWAMAV WIFAAINRRD LWEKAKKDQP EWNDTCTSHS SMVCQEDSLE EEWMGLLGYL SRISICKKKK DYCKMYRRHV RSRFYSIKDR. It is sometimes possible for the material contained within the vial of "NLRP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.