Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282633_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (AAA282633) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Human NMDAR1 Monoclonal Antibody | anti-GRIN1 antibody

NMDAR1 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NMDAR1, Antibody; NMDAR1 Rabbit mAb; NR1; MRD8; GluN1; NMDA1; DEE101; NDHMSD; NDHMSR; NMD-R1; NMDAR1; anti-GRIN1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
Applicable Applications for anti-GRIN1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NMDAR1 (Q05586).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (AAA282633) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA282633_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (AAA282633) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using NMDAR1 Rabbit mAb (AAA282633) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA282633_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using NMDAR1 Rabbit mAb (AAA282633) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of Mouse brain using NMDAR1 Rabbit mAb (AAA282633,dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.)

product-image-AAA282633_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of Mouse brain using NMDAR1 Rabbit mAb (AAA282633,dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse brain, using NMDAR1 Rabbit mAb (AAA282633) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA282633_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse brain, using NMDAR1 Rabbit mAb (AAA282633) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-GRIN1 antibody
The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 105kDa
Observed MW: 120kDa
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 1
UniProt Gene Name
GRIN1
UniProt Synonym Gene Names
NMDAR1; GluN1; NMD-R1
UniProt Entry Name
NMDZ1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GRIN1 grin1 (Catalog #AAA282633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMDAR1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMDAR1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the GRIN1 grin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SRSNAPATLT FENMAGVFML VAGGIVAGIF LIFIEIAYKR HKDARRKQMQ LAFAAVNVWR KNLQDRKSGR AEPDPKKKAT FRAITSTLAS SFKRRRSSKD T. It is sometimes possible for the material contained within the vial of "NMDAR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.