Mouse NME1 Monoclonal Antibody | anti-NME1 antibody

NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1) (AP)

Cat. Num. AAA25901

• Gene Names: NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• Applications: Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: NME1; Monoclonal Antibody; NME1 (Non-Metastatic Cells 1; Protein (NM23A) Expressed in; AWD; GAAD; NB; NBS; NDPK-A; NDPKA; NM23; NM23-H1) (AP); Non-Metastatic Cells 1; NM23-H1; anti-NME1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D7
• Specificity: Recognizes NME1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-NME1 antibody: Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME1 (NP_000260, 43aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Related Product Information for anti-NME1 antibody

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Product Categories/Family for anti-NME1 antibody

Antibodies; Protein Kinases

References

1. Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z.Toxicol Appl Pharmacol. 2009 Nov 1;240(3):393-400. Epub 2009 Aug 6.

NCBI and Uniprot Product Information

• NCBI GI #: 4557797
• NCBI GeneID: 4830
• NCBI Accession #: NP_000260
• NCBI GenBank Nucleotide #: NM_000269.2
• UniProt Accession #: P15531; Q6FGK3; Q86XQ2; Q9UDJ6
• Molecular Weight: 30,137 Da
• NCBI Official Full Name: nucleoside diphosphate kinase A isoform b
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 1
• NCBI Official Symbol: NME1
• NCBI Official Synonym Symbols: NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• NCBI Protein Information: nucleoside diphosphate kinase A
• UniProt Protein Name: Nucleoside diphosphate kinase A
• UniProt Gene Name: NME1
• UniProt Synonym Gene Names: NDPKA; NM23; NDK A; NDP kinase A; GAAD
• UniProt Entry Name: NDKA_HUMAN