WB (Western Blot)
(WB Suggested Anti-Nme1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Rabbit Nme1 Polyclonal Antibody | anti-NME1 antibody
Nme1 antibody - C-terminal region
Gene Names
Nme1; NM23A; NDPK-A; NM23-M1; AL024257
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot, Dot Blot
Purity
Affinity Purified
Synonyms
Nme1, Antibody; Nme1 antibody - C-terminal region; anti-NME1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEIS
Sequence Length
152
Applicable Applications for anti-NME1 antibody
WB (Western Blot), DB (Dot Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Nme1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
WB (Western Blot)
(WB Suggested Anti-Nme1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
WB (Western Blot)
(Lanes:1. 20 ug human MDA-MB-231 cell lysate2. 20 ug murine 4T1 primary breast tumor cell lysate3. 20 ug human MDA-MB-231 cell lysate4. 20 ug murine 4T1 primary breast tumor cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:Nme1Submitted by:Anonymous)
WB (Western Blot)
(Lanes:1. 20 ug human MDA-MB-231 cell lysate2. 20 ug murine 4T1 primary breast tumor cell lysate3. 20 ug human MDA-MB-231 cell lysate4. 20 ug murine 4T1 primary breast tumor cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:Nme1Submitted by:Anonymous)
DB (Dot Blot)
(DB Suggested Anti-Nme1 antibodyTitration: 0.5 ug/mlPositive Control: Recomninant human NME2 protein)
DB (Dot Blot)
(DB Suggested Anti-Nme1 antibodyTitration: 0.5 ug/mlPositive Control: Recomninant human NME2 protein)
Related Product Information for anti-NME1 antibody
This is a rabbit polyclonal antibody against Nme1. It was validated on Western Blot
Target Description: Nme1 has a major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. It possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. It is involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Itis required for neural development including neural patterning and cell fate determination.
Target Description: Nme1 has a major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. It possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. It is involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Itis required for neural development including neural patterning and cell fate determination.
Product Categories/Family for anti-NME1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
nucleoside diphosphate kinase A
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 1
NCBI Official Symbol
Nme1
NCBI Official Synonym Symbols
NM23A; NDPK-A; NM23-M1; AL024257
NCBI Protein Information
nucleoside diphosphate kinase A
UniProt Protein Name
Nucleoside diphosphate kinase A
UniProt Gene Name
Nme1
UniProt Synonym Gene Names
Nm23; NDK A; NDP kinase A
Similar Products
Product Notes
The NME1 nme1 (Catalog #AAA198257) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nme1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Nme1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), DB (Dot Blot). Researchers should empirically determine the suitability of the NME1 nme1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVVKTGRVML GETNPADSKP GTIRGDFCIQ VGRNIIHGSD SVKSAEKEIS. It is sometimes possible for the material contained within the vial of "Nme1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.