Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA31473_IHC6.jpg IHC (Immunohistchemistry) (AAA31473 at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

Mouse Nucleophosmin Monoclonal Antibody | anti-NPM1 antibody

Nucleophosmin Mouse Monoclonal Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity-chromatography.
Synonyms
Nucleophosmin, Antibody; Nucleophosmin Mouse Monoclonal Antibody; B23; MGC104254; NO38; NPM; NPM_HUMAN; NPM1; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Nucleophosmin (nucleolar phosphoprotein B23 numatrin); Nucleophosmin; nucleophosmin nucleoplasmin family member 1; Nucleophosmin/nucleoplasmin family member 1; Numatrin; OTTHUMP00000161024; OTTHUMP00000161025; OTTHUMP00000223397; OTTHUMP00000223398; anti-NPM1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
Nucleophosmin Antibody detects endogenous levels of total Nucleophosmin.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Applicable Applications for anti-NPM1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Application Notes
IHC: 1:50-1:200
WB: 1:500-1:2000
Immunogen
A synthesized peptide derived from human Nucleophosmin.
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohistchemistry)

(AAA31473 at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31473_IHC6.jpg IHC (Immunohistchemistry) (AAA31473 at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31473 at 1/100 staining mouse brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31473_IHC5.jpg IHC (Immunohistochemistry) (AAA31473 at 1/100 staining mouse brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31473 at 1/100 staining mouse kidney tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31473_IHC4.jpg IHC (Immunohistochemistry) (AAA31473 at 1/100 staining mouse kidney tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31473 at 1/100 staining human ovarian cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31473_IHC3.jpg IHC (Immunohistochemistry) (AAA31473 at 1/100 staining human ovarian cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31473 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31473_IHC2.jpg IHC (Immunohistochemistry) (AAA31473 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from various samples, using Nucleophosmin Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking peptide; Lane 2: Hela cells; Lane 3: B16F10-LUC cells. Lane 4: Rat lung tissue.)

product-image-AAA31473_WB.jpg WB (Western Blot) (Western blot analysis of extracts from various samples, using Nucleophosmin Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking peptide; Lane 2: Hela cells; Lane 3: B16F10-LUC cells. Lane 4: Rat lung tissue.)
Related Product Information for anti-NPM1 antibody
NPM1 a nucleolar protein associated with nucleolar ribonucleoprotein structures and that binds single-stranded nucleic acids. Is a major component of template activating factor (TAF)-III. It plays a role in controlling centrosome duplication, and may function in the assembly and/or transport of the ribosome. Two alternatively spliced isoforms have been described.
Product Categories/Family for anti-NPM1 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
37kD; 33kD(Calculated)

Similar Products

Product Notes

The NPM1 (Catalog #AAA31473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Nucleophosmin Mouse Monoclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Nucleophosmin can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). IHC: 1:50-1:200 WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NPM1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDSMDMDMS PLRPQNYLFG CELKADKDYH FKVDNDENEH QLSLRTVSLG AGAKDELHIV EAEAMNYEGS PIKVTLATLK MSVQPTVSLG GFEITPPVVL RLKCGSGPVH ISGQHLVAVE EDAESEDEEE EDVKLLSISG KRSAPGGGSK VPQKKVKLAA DEDDDDDDEE DDDEDDDDDD FDDEEAEEKA PVKKSIRDTP AKNAQKSNQN GKDSKPSSTP RSKGQESFKK QEKTPKTPKG PSSVEDIKAK MQASIEKGGS LPKVEAKFIN YVKNCFRMTD QEAIQDLWQW RKSL. It is sometimes possible for the material contained within the vial of "Nucleophosmin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.