Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282994_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of NIH/3T3 cells using PI3 Kinase p85 alpha/beta/gamma Rabbit mAb(AAA282994, dilution 1:200) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.)

Rabbit anti-Human PI3 Kinase p85 alpha/beta/gamma Monoclonal Antibody | anti-PIK3R1/PIK3R2/PIK3R3 antibody

PI3 Kinase p85 alpha/beta/gamma mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
PI3 Kinase p85 alpha/beta/gamma, Antibody; PI3 Kinase p85 alpha/beta/gamma mAb; PIK3R1/PIK3R2/PIK3R3; anti-PIK3R1/PIK3R2/PIK3R3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
Applicable Applications for anti-PIK3R1/PIK3R2/PIK3R3 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using PI3 Kinase p85 alpha/beta/gamma Rabbit mAb(AAA282994, dilution 1:200) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.)

product-image-AAA282994_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of NIH/3T3 cells using PI3 Kinase p85 alpha/beta/gamma Rabbit mAb(AAA282994, dilution 1:200) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.)

WB (Western Blot)

(Western blot analysis of various lysates, using PI3 Kinase p85 alpha/beta/gamma mAb (AAA282994) at 1:9000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 60s.)

product-image-AAA282994_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using PI3 Kinase p85 alpha/beta/gamma mAb (AAA282994) at 1:9000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 60s.)
Related Product Information for anti-PIK3R1/PIK3R2/PIK3R3 antibody
Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]
Product Categories/Family for anti-PIK3R1/PIK3R2/PIK3R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 42-54kDa/81-84kDa
Observed MW: 85kDa
UniProt Protein Name
Phosphatidylinositol 3-kinase regulatory subunit alpha
UniProt Gene Name
PIK3R1
UniProt Synonym Gene Names
GRB1; PI3-kinase regulatory subunit alpha; PI3K regulatory subunit alpha; PtdIns-3-kinase regulatory subunit alpha; PI3-kinase subunit p85-alpha
UniProt Entry Name
P85A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PIK3R1/PIK3R2/PIK3R3 pik3r1 (Catalog #AAA282994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PI3 Kinase p85 alpha/beta/gamma mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PI3 Kinase p85 alpha/beta/gamma can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PIK3R1/PIK3R2/PIK3R3 pik3r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVVELINHYR NESLAQYNPK LDVKLLYPVS KYQQDQVVKE DNIEAVGKKL HEYNTQFQEK SREYDRLYEE YTRTSQEIQM KRTAIEAFNE TIKIFEEQCQ T. It is sometimes possible for the material contained within the vial of "PI3 Kinase p85 alpha/beta/gamma, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.