Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Mouse anti-Human, Rat RAD18 Monoclonal Antibody | anti-RAD18 antibody

RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) APC

Gene Names
RAD18; RNF73
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD18, Antibody; RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) APC; EC=6.3.2.-; anti-RAD18 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H7
Specificity
Recognizes human RAD18. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RAD18 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 25ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa332-431 from human RAD18 (NP_064550) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RAD18 monoclonal antibody, Western Blot analysis of RAD18 expression in Hela NE.)

WB (Western Blot)

(Western blot analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged RAD18 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody. Lane 1: RAD18 transfected lysate (56.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

Product Categories/Family for anti-RAD18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RAD18
NCBI Official Synonym Full Names
RAD18 E3 ubiquitin protein ligase
NCBI Official Symbol
RAD18
NCBI Official Synonym Symbols
RNF73
NCBI Protein Information
E3 ubiquitin-protein ligase RAD18
UniProt Protein Name
E3 ubiquitin-protein ligase RAD18
UniProt Gene Name
RAD18
UniProt Synonym Gene Names
RNF73; hHR18; hRAD18
UniProt Entry Name
RAD18_HUMAN

Similar Products

Product Notes

The RAD18 rad18 (Catalog #AAA24630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAD18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD18 rad18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.