Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282747_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of RIPK1/RIP from 300 ug extracts of HeLa cells was performed using 3 ug of RIPK1/RIP Rabbit mAb (AAA282747). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using RIPK1/RIP Rabbit mAb (AAA282747) at a dilution of 1:500.)

Rabbit anti-Human RIPK1/RIP Monoclonal Antibody | anti-RIPK1 antibody

RIPK1/RIP Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
RIPK1/RIP, Antibody; RIPK1/RIP Rabbit mAb; RIP; RIP1; AIEFL; IMD57; RIP-1; RIPK1/RIP; anti-RIPK1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
YLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY
Applicable Applications for anti-RIPK1 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 289-490 of human RIPK1/RIP (NP_003795.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of RIPK1/RIP from 300 ug extracts of HeLa cells was performed using 3 ug of RIPK1/RIP Rabbit mAb (AAA282747). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using RIPK1/RIP Rabbit mAb (AAA282747) at a dilution of 1:500.)

product-image-AAA282747_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of RIPK1/RIP from 300 ug extracts of HeLa cells was performed using 3 ug of RIPK1/RIP Rabbit mAb (AAA282747). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using RIPK1/RIP Rabbit mAb (AAA282747) at a dilution of 1:500.)

WB (Western Blot)

(Western blot analysis of various lysates using RIPK1/RIP Rabbit mAb (AAA282747) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA282747_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using RIPK1/RIP Rabbit mAb (AAA282747) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-RIPK1 antibody
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 76kDa
Observed MW: 75kDa
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 1
UniProt Gene Name
RIPK1
UniProt Synonym Gene Names
RIP; RIP1; RIP-1
UniProt Entry Name
RIPK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RIPK1 ripk1 (Catalog #AAA282747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK1/RIP Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK1/RIP can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the RIPK1 ripk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YLSQLEESVE EDVKSLKKEY SNENAVVKRM QSLQLDCVAV PSSRSNSATE QPGSLHSSQG LGMGPVEESW FAPSLEHPQE ENEPSLQSKL QDEANYHLYG SRMDRQTKQQ PRQNVAYNRE EERRRRVSHD PFAQQRPYEN FQNTEGKGTA YSSAASHGNA VHQPSGLTSQ PQVLYQNNGL YSSHGFGTRP LDPGTAGPRV WY. It is sometimes possible for the material contained within the vial of "RIPK1/RIP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.