Mouse anti-Human RLIM Monoclonal Antibody | anti-RLIM antibody

RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) APC

Cat. Num. AAA24635

• Gene Names: RLIM; MRX61; RNF12; TOKAS; NY-REN-43
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RLIM, Antibody; RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) APC; EC=6.3.2.-; MGC15161; anti-RLIM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G10
• Specificity: Recognizes human RNF12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RLIM antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 30ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-84 from human RNF12 (NP_057204) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RNF12 monoclonal antibody, Western Blot analysis of RNF12 expression in HeLa NE.)

Application Data

(Detection limit for recombinant GST tagged RNF12 is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of RNF12 transfected lysate using RNF12 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF12 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RNF12 on HeLa cell. [antibody concentration 30ug/ml].)

WB (Western Blot)

(Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody. Lane 1: RNF12 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.24kD).)

Product Categories/Family for anti-RLIM antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 34452684
• NCBI GeneID: 51132
• NCBI Accession #: NP_057204
• NCBI GenBank Nucleotide #: NM_016120
• UniProt Accession #: Q9NVW2
• Molecular Weight: 68kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase RLIM
• NCBI Official Synonym Full Names: ring finger protein, LIM domain interacting
• NCBI Official Symbol: RLIM
• NCBI Official Synonym Symbols: MRX61; RNF12; TOKAS; NY-REN-43
• NCBI Protein Information: E3 ubiquitin-protein ligase RLIM
• UniProt Protein Name: E3 ubiquitin-protein ligase RLIM
• UniProt Gene Name: RLIM
• UniProt Synonym Gene Names: RNF12; R-LIM
• UniProt Entry Name: RNF12_HUMAN