Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.)

Mouse RUNX1 Monoclonal Antibody | anti-RUNX1 antibody

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (FITC)

Gene Names
RUNX1; AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; AML1-EVI-1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
RUNX1, Antibody; RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (FITC); Runt-Related Transcription Factor 1; AML1; AML1-EVI-1; AMLCR1; CBFA2; EVI-1; PEBP2aB; anti-RUNX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C10
Specificity
Recognizes RUNX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RUNX1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RUNX1 (NP_001001890.1, 210aa-310aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml])

WB (Western Blot)

(RUNX1 monoclonal antibody (M06), clone 2C10 Western Blot analysis of RUNX1 expression in Hela S3 NE (Cat # L013V3).)

WB (Western Blot) (RUNX1 monoclonal antibody (M06), clone 2C10 Western Blot analysis of RUNX1 expression in Hela S3 NE (Cat # L013V3).)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml])

Application Data (Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml])
Related Product Information for anti-RUNX1 antibody
Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-RUNX1 antibody
References
1. Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.Niu DF, Kondo T, Nakazawa T, Oishi N, Kawasaki T, Mochizuki K, Yamane T, Katoh R.Lab Invest. 2012 May 28. doi: 10.1038/labinvest.2012.84. 2.Megakaryocytic expression of miRNA 10a, 17-5p, 20a and 126 in Philadelphia chromosome-negative myeloproliferative neoplasm.Hussein K, Dralle W, Theophile K, Kreipe H, Bock O.Ann Hematol. 2009 Apr;88(4):325-32. Epub 2008 Sep 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
861
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,737 Da
NCBI Official Full Name
runt-related transcription factor 1 isoform AML1b
NCBI Official Synonym Full Names
runt-related transcription factor 1
NCBI Official Symbol
RUNX1
NCBI Official Synonym Symbols
AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; AML1-EVI-1
NCBI Protein Information
runt-related transcription factor 1; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; oncogene AML-1; AML1-EVI-1 fusion protein; acute myeloid leukemia 1 protein; SL3-3 enhancer factor 1 alpha B subunit; SL3/AKV core-binding factor alpha B subunit; core-binding
UniProt Protein Name
Runt-related transcription factor 1
UniProt Gene Name
RUNX1
UniProt Synonym Gene Names
AML1; CBFA2; CBF-alpha-2; PEA2-alpha B
UniProt Entry Name
RUNX1_HUMAN

Similar Products

Product Notes

The RUNX1 runx1 (Catalog #AAA26348) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RUNX1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX1 runx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.