Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198235_WB13.jpg WB (Western Blot) (WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateRUNX1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit RUNX1 Polyclonal Antibody | anti-RUNX1 antibody

RUNX1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RUNX1; AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RUNX1, Antibody; RUNX1 antibody - N-terminal region; anti-RUNX1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP
Sequence Length
107
Applicable Applications for anti-RUNX1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RUNX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateRUNX1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA198235_WB13.jpg WB (Western Blot) (WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateRUNX1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: MouseTarget Name: RUNX1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA198235_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: RUNX1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-RUNX1 antibody
This is a rabbit polyclonal antibody against RUNX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. RUNX1 is the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with severaltypes of leukemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
861
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
acute myeloid leukemia 1 protein, partial
NCBI Official Synonym Full Names
runt related transcription factor 1
NCBI Official Symbol
RUNX1
NCBI Official Synonym Symbols
AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha
NCBI Protein Information
runt-related transcription factor 1
UniProt Protein Name
Runt-related transcription factor 1
UniProt Gene Name
RUNX1
UniProt Synonym Gene Names
AML1; CBFA2; CBF-alpha-2; PEA2-alpha B
UniProt Entry Name
RUNX1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RUNX1 runx1 (Catalog #AAA198235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RUNX1 runx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMPAAPRGPA QGEAAARTRS RDASTSRRFT PPSTALSPGK MSEALPLGAP. It is sometimes possible for the material contained within the vial of "RUNX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.