Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26244_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell. [antibody concentration 10 ug/ml])

Mouse RUNX2 Monoclonal Antibody | anti-RUNX2 antibody

RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
RUNX2; CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
RUNX2, Antibody; RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (Biotin); Runt-Related Transcription Factor 2; AML3; CBFA1; CCD; CCD1; MGC120022; MGC120023; OSF2; PEA2aA; PEBP2A1; PEBP2A2; PEBP2aA; PEBP2aA1; anti-RUNX2 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D5
Specificity
Recognizes RUNX2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RUNX2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RUNX2 (NP_004339, 251aa-350aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell. [antibody concentration 10 ug/ml])

product-image-AAA26244_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell. [antibody concentration 10 ug/ml])

product-image-AAA26244_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell. [antibody concentration 10 ug/ml])

Application Data

(Detection limit for recombinant GST tagged RUNX2 is approximately 10ng/ml as a capture antibody.)

product-image-AAA26244_APP4.jpg Application Data (Detection limit for recombinant GST tagged RUNX2 is approximately 10ng/ml as a capture antibody.)

WB (Western Blot)

(RUNX2 monoclonal antibody (M04), clone 4D5 Western Blot analysis of RUNX2 expression in PC-12 (Cat # L012V1).)

product-image-AAA26244_WB3.jpg WB (Western Blot) (RUNX2 monoclonal antibody (M04), clone 4D5 Western Blot analysis of RUNX2 expression in PC-12 (Cat # L012V1).)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

product-image-AAA26244_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

product-image-AAA26244_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])
Related Product Information for anti-RUNX2 antibody
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq]
Product Categories/Family for anti-RUNX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
860
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
Runt-related transcription factor 2
NCBI Official Synonym Full Names
runt related transcription factor 2
NCBI Official Symbol
RUNX2
NCBI Official Synonym Symbols
CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
NCBI Protein Information
runt-related transcription factor 2
UniProt Protein Name
Runt-related transcription factor 2
UniProt Gene Name
RUNX2
UniProt Synonym Gene Names
AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A
UniProt Entry Name
RUNX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RUNX2 runx2 (Catalog #AAA26244) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RUNX2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX2 runx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.