Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283088_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse lung tissue using SFTPC Rabbit PolymAb® (A26944-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit anti-Human SFTPC Monoclonal Antibody | anti-SFTPC antibody

SFTPC Rabbit PolymAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
SFTPC, Antibody; SFTPC Rabbit PolymAb; SP5; SP-C; PSP-C; SFTP2; SMDP2; BRICD6; anti-SFTPC antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
TATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Applicable Applications for anti-SFTPC antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 91-190 of human SFTPC (NP_003009.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse lung tissue using SFTPC Rabbit PolymAb® (A26944-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA283088_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse lung tissue using SFTPC Rabbit PolymAb® (A26944-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human lung tissue using SFTPC Rabbit PolymAb® (A26944-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA283088_ICC10.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human lung tissue using SFTPC Rabbit PolymAb® (A26944-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human lung tissue using SFTPC Rabbit PolymAb® (AAA283088) at a dilution of 1:13000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA283088_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human lung tissue using SFTPC Rabbit PolymAb® (AAA283088) at a dilution of 1:13000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using SFTPC Rabbit PolymAb® (AAA283088) at a dilution of 1:13000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA283088_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using SFTPC Rabbit PolymAb® (AAA283088) at a dilution of 1:13000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from 293T cells using SFTPC Rabbit PolymAb® (AAA283088) at 1:10000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 20 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 0.5s.)

product-image-AAA283088_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from 293T cells using SFTPC Rabbit PolymAb® (AAA283088) at 1:10000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 20 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 0.5s.)
Related Product Information for anti-SFTPC antibody
This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 21kDa
Observed MW: 21kDa
UniProt Protein Name
Pulmonary surfactant-associated protein C
UniProt Gene Name
SFTPC
UniProt Synonym Gene Names
SFTP2; SP-C
UniProt Entry Name
PSPC_HUMAN

Similar Products

Product Notes

The SFTPC sftpc (Catalog #AAA283088) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFTPC Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SFTPC can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SFTPC sftpc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TATFSIGSTG LVVYDYQQLL IAYKPAPGTC CYIMKIAPES IPSLEALTRK VHNFQMECSL QAKPAVPTSK LGQAEGRDAG SAPSGGDPAF LGMAVSTLCG. It is sometimes possible for the material contained within the vial of "SFTPC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.