Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Application Data (Detection limit for recombinant GST tagged SHMT1 is ~1ng/ml as a capture antibody.)

Mouse anti-Human SHMT1 Monoclonal Antibody | anti-SHMT1 antibody

SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (HRP)

Gene Names
SHMT1; SHMT; CSHMT
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SHMT1; Monoclonal Antibody; SHMT1 (Serine Hydroxymethyltransferase; Cytosolic; SHMT; Serine Methylase; Glycine Hydroxymethyltransferase; MGC15229; MGC24556) (HRP); anti-SHMT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F9
Specificity
Recognizes human SHMT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SHMT1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa374-482 from human SHMT1 (NP_004160) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SHMT1 is ~1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged SHMT1 is ~1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1ug/ml].)

WB (Western Blot)

(Western Blot analysis of SHMT1 expression in transfected 293T cell line by SHMT1 monoclonal antibody. Lane 1: SHMT1 transfected lysate (53.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of SHMT1 expression in transfected 293T cell line by SHMT1 monoclonal antibody. Lane 1: SHMT1 transfected lysate (53.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SHMT1 monoclonal antibody, Western Blot analysis of SHMT1 expression in HeLa.)

WB (Western Blot) (SHMT1 monoclonal antibody, Western Blot analysis of SHMT1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.73kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.73kD).)
Product Categories/Family for anti-SHMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,672 Da
NCBI Official Full Name
serine hydroxymethyltransferase, cytosolic isoform 1
NCBI Official Synonym Full Names
serine hydroxymethyltransferase 1 (soluble)
NCBI Official Symbol
SHMT1
NCBI Official Synonym Symbols
SHMT; CSHMT
NCBI Protein Information
serine hydroxymethyltransferase, cytosolic; cytoplasmic serine hydroxymethyltransferase; glycine hydroxymethyltransferase; serine methylase
UniProt Protein Name
Serine hydroxymethyltransferase, cytosolic
UniProt Gene Name
SHMT1
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYC_HUMAN

Similar Products

Product Notes

The SHMT1 shmt1 (Catalog #AAA25541) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHMT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SHMT1 shmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHMT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.